SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000003126 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000003126
Domain Number 1 Region: 30-92
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000737
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 2 Region: 87-145
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000128
Family Complement control module/SCR domain 0.0009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000003126   Gene: ENSOARG00000002942   Transcript: ENSOART00000003186
Sequence length 149
Comment pep:novel scaffold:Oar_v3.1:JH922081.1:5915:12447:1 gene:ENSOARG00000002942 transcript:ENSOART00000003186 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKPVSGRKSPVLYLLGILTVLLCPDSLQGCSAPPEVKHGHFTYIEREIFGTDVVEYECQE
GYTLVGEARISCTFFNWSPPAPQCKAVCQNPEISNGKLSVEKDQYVTPENVTITCDPGYR
MVGSQNIFCSENKSWSPDVPKCEKVSNSQ
Download sequence
Identical sequences W5NY78
XP_004022893.1.66739 ENSOARP00000003126

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]