SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000003127 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000003127
Domain Number 1 Region: 25-418
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 1.44e-107
Family Regulator of chromosome condensation RCC1 0.00000000000168
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000003127   Gene: ENSOARG00000002939   Transcript: ENSOART00000003187
Sequence length 422
Comment pep:known_by_projection chromosome:Oar_v3.1:2:237759741:237767051:-1 gene:ENSOARG00000002939 transcript:ENSOART00000003187 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPPKRVAKRRSPPEDALPKIFNLKFSHRSHGTEPGMVLTLGQGDVGQLGLGENVMERKKP
ALVSIPEDIVQAEAGGMHTVCLSKSGQVYSFGCNDEGALGRDTSVEGSEMVPGKVDLQEK
VVQVSAGDSHTAALTEDGRVFLWGSFRDNNGVIGLLEPMKKSMVPVQVQLSMPVMKVASG
NDHLVMLTVDGDLYTLGSGEQGQLGRVPELFANRGGRQGLERLLVPKCVMLKSRGSRGHV
RFQDAFCGAYFTFAISSEGHVYGFGLSNYHQLGTQGTESCFIPQNLTSFKNSTKSWVGFS
GGQHHTVCMDSEGKAYSLGRAEYGRLGLGEGAEEKSVPTLISRLPTVSSVACGASVGYAV
TKDGRVFAWGMGTNYQLGTGQDEDAWSPVEMTGKQLENRVVLTVSSGGQHTVLLVKDKEQ
SW
Download sequence
Identical sequences W5NY79
ENSOARP00000003127

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]