SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000003149 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000003149
Domain Number 1 Region: 455-708
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.37e-52
Family Eukaryotic proteases 0.0000669
Further Details:      
 
Domain Number 2 Region: 188-455
Classification Level Classification E-value
Superfamily vWA-like 1.67e-50
Family Integrin A (or I) domain 0.0000146
Further Details:      
 
Domain Number 3 Region: 83-144
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000486
Family Complement control module/SCR domain 0.00033
Further Details:      
 
Domain Number 4 Region: 150-206
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000153
Family Complement control module/SCR domain 0.00046
Further Details:      
 
Domain Number 5 Region: 24-92
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000667
Family Complement control module/SCR domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000003149   Gene: ENSOARG00000002951   Transcript: ENSOART00000003209
Sequence length 731
Comment pep:novel chromosome:Oar_v3.1:20:26550405:26561667:-1 gene:ENSOARG00000002951 transcript:ENSOART00000003209 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPLMAVLCLLPLYPGLATAALSCPKNVNISGGSFTLSNGWSPGSILTYSCPLGRYPYPV
ATRLCKSNGQWQIPRSTRLTKAICKPVRCPAPVSFENGVYIPRLGSHPVGGNLTFECEDG
FTLRGSAVRQCRPNGMWDGETAVCDNGASHCPNPGISVGAVRTGSRFGLGDKVRYRCSSN
LVLTGSAERECQDDGVWSGTEAICRQPYSYDFPEDVAPALGTSFSHLLATTNPIQQKKNN
LGRKIQIQRSGHLNLYLLLDASQSVSKDDFEIFKDSASHMVDRIFSFEIKVSVAIITFAS
KPKIIMSVLDDRSRDVTEVENSLRNINYKDHENGTGTNIYEALHAVYIMMNNQMNRLRMN
PVAWQEIRHAIILLTDGKSNMGGSPKVAVDNIKEVLNINQKRKDFLDIYAIGVGSLQVDW
KELNNLGSKKDGERHAFILKDVQALSQVFEHMLDISQLTDPICGVGNMSANASAQERTPW
HVTIKPKSQETCRGALISDQWVLTAAHCLSNAEDRTLWRVSVGDPNFQGSKEFQIEKAEI
SPGFNVFSKKNQGIPEFYGDDIALLKLTQKVKMSTHARPICLPCTVGANLALRRLPGSTC
RDHEKELLNQVSIPAHFVALNGDKLNINLKTGSEWTNCVKVVSKDKTTFPNLTDVREVVT
DQFLCSGTQGDDSPCKGESGGAVFLERRLRFFQVGLVSWGLYNPCGSSSKNSRKPAPHGK
VPRDFHINLFR
Download sequence
Identical sequences W5NYA1
ENSOARP00000003149

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]