SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000003158 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000003158
Domain Number 1 Region: 12-248
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.47e-67
Family Eukaryotic proteases 0.000000921
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000003158   Gene: ENSOARG00000002970   Transcript: ENSOART00000003218
Sequence length 250
Comment pep:novel scaffold:Oar_v3.1:JH922646.1:7794:11347:1 gene:ENSOARG00000002970 transcript:ENSOART00000003218 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQLPLHLMAFLLPPGLGHPFLSEEIIGGHEAKPHSHPYMALVQYLGENGWKRCGGVLIQK
DFVLTVAHCRGSSINVTLGAHNIKQQERTQQVIWVRRAIRHPDYNPKNFSNDIILLQLER
KAKQTSAVKPLSLPKAKARVKPGQVCSLAGWGQVAPGTPATTLQQAELTVQEDRVCESLD
HSPYSRATQKCVGDPRKVKTSFKGDSGGPLVCKKVVHGIFFYGKANGKPPGIFTQVSHFL
PWIKRTMKQL
Download sequence
Identical sequences W5NYB0
ENSOARP00000003158 XP_004022982.1.66739

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]