SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000003182 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000003182
Domain Number 1 Region: 26-254
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 6.36e-74
Family Eukaryotic proteases 0.000000323
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000003182   Gene: ENSOARG00000002990   Transcript: ENSOART00000003242
Sequence length 256
Comment pep:known_by_projection scaffold:Oar_v3.1:JH922372.1:21:5776:1 gene:ENSOARG00000002990 transcript:ENSOART00000003242 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSNSEHEADANKVHSVGAHKQNSPFPSGEIIGGREAKPHSRPYMAYLQYWNQDVQSRCG
GFLVREDFVLTAAHCHGSSMNVTLGAHNIKQQERTQQVIGVRRAICHPDYNPKNFSNDIM
LLKLERKAKQTSAVKPLRLPRAKARVKPGQVCSVAGWGRDSTGSYADTLQEVKLTVQEDG
RCEAYLRNYYNRANQLCVGDPKTKKATFKGDSGGPLVCDNVAQGIVSYGREDGSTPRAFT
KVSTFLPWIKKTMKSL
Download sequence
Identical sequences W5NYD4
XP_004022950.1.66739 ENSOARP00000003182

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]