SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000003184 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000003184
Domain Number 1 Region: 18-123
Classification Level Classification E-value
Superfamily Immunoglobulin 2.01e-18
Family V set domains (antibody variable domain-like) 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000003184   Gene: ENSOARG00000002992   Transcript: ENSOART00000003244
Sequence length 130
Comment pep:novel scaffold:Oar_v3.1:AMGL01124456.1:544:1502:1 gene:ENSOARG00000002992 transcript:ENSOART00000003244 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PMMLKMHILNLQTQAGVTAYRRVTGVAGRSVTLPCYYNGEVTSMCWGRGSCPWFDCGTNI
IWTDGFRVTYRRDGRYQLNGNIPGRDVSLTINNAAVSDTGLYCCRIEVRGWFNDIKTTLE
LKVNPGELIF
Download sequence
Identical sequences W5NYD6
ENSOARP00000003184

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]