SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000003258 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000003258
Domain Number 1 Region: 13-319,423-464
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 6.99e-74
Family FAD-linked reductases, N-terminal domain 0.000000000198
Further Details:      
 
Domain Number 2 Region: 299-409
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 5.36e-36
Family L-aminoacid/polyamine oxidase 0.000000771
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000003258   Gene: ENSOARG00000003052   Transcript: ENSOART00000003319
Sequence length 527
Comment pep:known chromosome:Oar_v3.1:X:40680225:40760099:1 gene:ENSOARG00000003052 transcript:ENSOART00000003319 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESLQKTSDAGQMFDVVVIGGGISGLSAAKLLAEHEVNVLVLEARERVGGRTYTVRNEHV
DYVDVGGAYVGPTQNRILRLSKQLGLETYKVNVNERLVHYVKGKTYPFRGAFPPVWNPIA
YLDYNNLWRTMDNMGKEIPADAPWEAPHAAEWDKMTMKDLIEKICWTKTARQFASLFVNI
NVTSEPHEVSALWFLWYVKQCGGTTRIFSITNGGQERKFVGGSGQVSERIMQLLGDRVKL
RSPVTYVDQSSENITIETLNRELYECQYVISAIPPTLTSKIHFRPELPSERNQLIQRLPM
GAIIKCMMYYKEAFWKKKDYCGCMIIEDEEAPISITLDDTKPDGSLPAIMGFILARKADR
LAKEHKDIRKRKICELYAKVLGSQEALHPVHYEEKNWCQEQYSGGCYTAYYPPGIMTQYG
RVIRQPVGRIYFAGTETATQWSGYMEGAVEAGERAAREVLNALGKLAAKDIWIQEPEAED
VPAVEITPSFWERNLPSVPGLLKIVGFSTSMTALWFVMYRFRLLSRS
Download sequence
Identical sequences W5NYL0
XP_012013866.1.54773 ENSOARP00000003258

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]