SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000003297 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000003297
Domain Number 1 Region: 289-436,478-573,606-628
Classification Level Classification E-value
Superfamily RNI-like 0.0000000000000196
Family 28-residue LRR 0.072
Further Details:      
 
Domain Number 2 Region: 20-75
Classification Level Classification E-value
Superfamily F-box domain 0.0000000262
Family F-box domain 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000003297   Gene: ENSOARG00000003096   Transcript: ENSOART00000003359
Sequence length 725
Comment pep:known_by_projection chromosome:Oar_v3.1:24:38690567:38707171:1 gene:ENSOARG00000003096 transcript:ENSOART00000003359 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ASADGREDTCDDSDAPPAAAPVADSTHLLGFSDEILLHILSHVPSTDLVLNVRRTCRKLA
ALCLDKSLTHTVLLQKDYEVRSPEVAPGAGAEGGAAGALECLECVFHLGGSRCGHRCRDT
IVCTSLTHTDARCHVVASRLAGALTAGTRRLPLAIDVSPGFDASQLSGECKATLSRVREL
KQTLYTPSYGVVPCCTSLEKLLLYFEILDRTREGAVLSGQLMVGQSNVPHYQHLRVFYAR
LAPGYINQEVVRLYLAVLSDRTPENLHAFLISVPGSFAESGATRNLLESMARNVALDALQ
LPKSWLNGSALLQHMKFSSPFYFSFSRCALSGGHLLQRVIDGGRDLRSLAGLNLSGCAHC
LAPDCLLRKAEDDIDPAILEALVAACPNLRHLNLSAAHHHSPEGPGQHLCQLLARLPRLR
SLSLPVCAVADSPPRADRAPVPPAMRAVPRGFGKKVRIGVPSVPFPGPAGPQPSSVFWSL
LKNVPFLDRLELIGSNFSSAMPRNEPAIRNSLPPCSRAQSVGDAEVAAIGQLAFLRHLTL
AQLPSILTGSGLVSIGLQCQQLQSLSLAHLGLMGKVVYMSGLSDMLKHCKRLKARPLEQP
YFSANAQFFQALSQCSALQRLCLVSRSGTLQPEAVLAFMARCLRVVVCHLFTGESLSTCR
SLQQALLRRLSPRPPRGGACCPRVRKVEGCSDVLAEGWPPGPCPRRDEVTLFKSRVAEEP
PNLWW
Download sequence
Identical sequences W5NYP9
ENSOARP00000003297

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]