SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000003335 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000003335
Domain Number 1 Region: 853-911
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000157
Family TSP-1 type 1 repeat 0.0039
Further Details:      
 
Domain Number 2 Region: 48-105
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000759
Family TSP-1 type 1 repeat 0.0013
Further Details:      
 
Domain Number 3 Region: 623-689
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000107
Family TSP-1 type 1 repeat 0.0033
Further Details:      
 
Domain Number 4 Region: 744-798
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000112
Family TSP-1 type 1 repeat 0.0073
Further Details:      
 
Domain Number 5 Region: 794-858
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000772
Family TSP-1 type 1 repeat 0.0032
Further Details:      
 
Domain Number 6 Region: 566-626
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000085
Family TSP-1 type 1 repeat 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000003335   Gene: ENSOARG00000003129   Transcript: ENSOART00000003398
Sequence length 916
Comment pep:known_by_projection chromosome:Oar_v3.1:3:2371399:2402064:-1 gene:ENSOARG00000003129 transcript:ENSOART00000003398 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGRWQPSRWARALLAVALVTGSASSTGTTDNSPTSNSLEVGPDATAYWWGEWTKWTACS
RSCGAGVTSQERHCLQQRKTSVTGAGNRTCTGTSKRYQLCRVQECPPDGRSFREEQCISF
NSRVYNGRTHQWKPLYPDDYVHISSKPCDLHCTTVDGQRQLMVPARDGTSCKLADLRGVC
VSGKCEPIGCDGVLFSTHTLDKCGVCQGDGSSCTHVTGNYRKGNTHLGYSLVTHIPAGAR
DIQIVERKKSADVLALADEAGYFFFNGNFKVDSPKNFNIAGTVVKYRRPMDVYETGIEYI
VAQGPTNQGLNVMLWSLAGLWMEKRLSGPTHLSPGCSLFYQLYPHVSLATVSTFRLIMAP
SLPRVGLLQHNASLFGQASSERLGLDNRLFGHRGPGIELGLSRGQETNEVCAQASGRACE
GPPRGKGFRDGNATWTALVGDPDDREADTRFASQELLSANAISDQLLGAGSDSRELPLNE
TVNSIFSQGAPRGSPAESLYLDYEESEGAGAYLLNGSYLELSSDRLANTSSEAPFPNASA
SFPALAGNRTQKARTRPKSRKQGVSPADMYRWKLSSHEPCSSTCTTGVLSTYAMCVRYDG
IEVDDSYCDALTRPEPVQEFCAGRECQPRWETSSWSECSRTCGEGFQFRVVRCWKMLSPG
FDSSVYSDLCEAAEAVRPEERKTCRGPACGPQWEMSQWSEPPPKCGERSVVTRDIRCSED
EKLCDPSTRPVGEKDCAGPPCDRQWTVSDWGPCSGSCGQGRMIRHVYCKTSDGRVVPESQ
CQMESKPLAIHPCGDKNCPAHWLAQDWERCNTTCGRGVKKRLVLCMELANGKPQTRSGPE
CGLAKKPPEESTCFERPCFKWYTSPWSECTETGGLGVRMRDVKCYQGTDIVRGCDPLAKP
VGRQACDLQPCPTAPP
Download sequence
Identical sequences W5NYT7
ENSOARP00000003335

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]