SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000003354 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000003354
Domain Number 1 Region: 245-295
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000876
Family TSP-1 type 1 repeat 0.00046
Further Details:      
 
Domain Number 2 Region: 155-246
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000179
Family I set domains 0.025
Further Details:      
 
Domain Number 3 Region: 299-353
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000719
Family TSP-1 type 1 repeat 0.00058
Further Details:      
 
Domain Number 4 Region: 813-896
Classification Level Classification E-value
Superfamily DEATH domain 0.0000000181
Family DEATH domain, DD 0.00073
Further Details:      
 
Domain Number 5 Region: 48-150
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000133
Family I set domains 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000003354   Gene: ENSOARG00000003149   Transcript: ENSOART00000003418
Sequence length 906
Comment pep:known_by_projection chromosome:Oar_v3.1:5:35756308:35820750:1 gene:ENSOARG00000003149 transcript:ENSOART00000003418 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVRSGLWPALLGIVLAAWLRGSGAQQSATVANPVPNPVPGSNPDLLPHFLVEPEDVYIV
KNKPVLLVCKATPATQIFFKCNGEWVRQVDHVIERSTDGSSGLPSMEVRINVSRQQVEKV
FGLEEFWCQCVAWSSSGTTKSQKAYIRIAYLRKNFEQEPLAKEVSLEQGIVLPCRPPEGI
PPAEVEWLRNEDLVDPSMDPNVYITREHSLVVRQARLADTANYTCVAKNIVARRRSASAA
VIVYVNGGWSTWTEWSVCSASCGRGWQKRSRSCTNPAPLNGGAFCEGQNVQKTACATLCP
VDGSWSPWSKWSACGLDCTHWRSRECSDPAPRNGGEECQGADLDTRNCTSDLCVHTASGP
EDVALYVGLIAVAVCLLLLLLVLILVYCRKKEGLDSDVADSSILTSGFQPVSIKPSKADS
PHLLTIQPDLSTTTTTYQGSLCPRQDGPSPKFQLTNGHLLSPLGSGRHTLHHSSPTSEAE
DFVSRLSTQNYFRSLPRGTSNMAYGTFNFLGGRLMIPNTGISLLIPPDAIPRGKIYEIYL
TLHKPEDVRLPLAGCQTLLSPIVSCGPPGVLLTRPVILTMDHCGEPSPESWSLRLKKQSC
EGSWEDVLHLGEEAPCHLYYCQLEAGACYVFTEQLGLFALVGEALSVAVAKSLKLLLFAP
MVACTSLEYNIRVYCLHDTHDALKEVVQLEKQLGGQLIQEPRVLHFKDSYHNLRLSIHDV
PSSLWKSKLLVSYQEIPFYHIWNGTQQHLHCTFTLERVSPSTSDLACKVWVWQVEGDGQS
FNVNFNITKDTRFSELLVLESEGGVPALVGPSAFKIPFLIRQKIITSLDPPCSRGADWRT
LAQKLHLDRWVAGGQGGDMKATCSPAWAGMWGSRVIPNGNLSQLAAAVAGLGQPDAGLFT
VSEAEC
Download sequence
Identical sequences W5NYV6
ENSOARP00000003354

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]