SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000003409 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000003409
Domain Number 1 Region: 1-96
Classification Level Classification E-value
Superfamily Kringle-like 9.42e-26
Family Kringle modules 0.0009
Further Details:      
 
Domain Number 2 Region: 184-291
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.09e-24
Family Spermadhesin, CUB domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000003409   Gene: ENSOARG00000003201   Transcript: ENSOART00000003473
Sequence length 434
Comment pep:known_by_projection chromosome:Oar_v3.1:17:67965597:67999531:1 gene:ENSOARG00000003201 transcript:ENSOART00000003473 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ECFTANGADYRGTQNWTALQGGKPCLFWNETFQHPYNTLKYPNGEGGVGEHNYCRNPDGD
VSPWCYVAEHEDGVYWKYCEIPTCQMPGNLGCYKDHGNPPPLTGTSKTSNKLTIQNCISF
CRSQRFKFAGIESGYACFCGNDPDYWKDGEAASTECSSVCFGDHTQPCGGDGRVIIFDTL
VGACGGNYSAMTSVVYSPDFPDAYAAGRVCYWTIRVPGAAHIHFNFTLFDIRDSADMVEL
LDGYTHRVLVRFNGRNRPPSSFNISLDFIILYFFSDRINQAQGFAVLYQAIKEDPPQEKP
TDNQMLAEVITEQANFSVSAARSSKVLYVITTSPSHPRQTVPGWTVYGLATLLILTVTAI
VAKILLHITFRSHRVPASGDLRDCHQPGTSGEIWSIFYEPSTSISIFKKKLKCQSQPDDR
NPLVPPPPCPAPEG
Download sequence
Identical sequences W5NZ11
ENSOARP00000003409

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]