SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000003474 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000003474
Domain Number 1 Region: 40-206
Classification Level Classification E-value
Superfamily TIMP-like 1.88e-67
Family Tissue inhibitor of metalloproteinases, TIMP 0.000000018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000003474   Gene: ENSOARG00000003264   Transcript: ENSOART00000003538
Sequence length 217
Comment pep:known_by_projection chromosome:Oar_v3.1:11:52490463:52504223:1 gene:ENSOARG00000003264 transcript:ENSOART00000003538 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LGLPALASRLPAANSAQIPSTSEPGRSCGGLCSPLHLCFTVIRAKAVSKKEVDSGNDIYG
NPIKRIQYEIKQIKMFKGPDQDIEFIYTAPSSAVCGVSLDIGGKKEYLIAGKAEGNGNMH
ITLCDFIVPWDTLSATQKKSLNHRYQMGCECKITRCPMIPCYISSPDECLWMDWVTEKNI
NGHQAKFFACIKRSDGSCAWYRGAAPPKQEFLDIEDP
Download sequence
Identical sequences W5NZ76
ENSOARP00000003474

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]