SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000003506 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000003506
Domain Number 1 Region: 61-170
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.14e-24
Family Spermadhesin, CUB domain 0.00058
Further Details:      
 
Domain Number 2 Region: 256-362
Classification Level Classification E-value
Superfamily Cystine-knot cytokines 8.76e-20
Family Platelet-derived growth factor-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000003506   Gene: ENSOARG00000003293   Transcript: ENSOART00000003570
Sequence length 370
Comment pep:known_by_projection chromosome:Oar_v3.1:15:3848546:4133998:1 gene:ENSOARG00000003293 transcript:ENSOART00000003570 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHRLILVYTLVCANFCSYRDTSATPQSASIKALRNANLRRDESNHLTDLYRRDETIQVTG
HGHVQSPRFPNSYPRNLLLTWRLHSQEKTRIQLAFDNQFGLEEAENDICRYDFVEVEDIS
ETSTVIRGRWCGHKEVPPRITSRTNQIKITFKSDDYFVAKPGFKIYYSFVEDFQPAAASE
TNWESVTSSISGVSYHSPSVTDPTLTADALDKTIAEFDTVEELLKHFNPESWQDDLENLY
LDTPHHRGRSYHDRKSKVDLDRLNDDVKRYSCTPRNYSVNLREELKLTNVVFFPRCLLVQ
RCGGNCGCGTVNWKSCACNSGKTVKKYHEVLKFEPGHFKRRGRAKHMALVDIQLDHHERC
DCICSSRPPR
Download sequence
Identical sequences W5NZA8
XP_004016014.1.66739 ENSOARP00000003506

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]