SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000003507 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000003507
Domain Number 1 Region: 47-241,345-385
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.33e-44
Family FAD-linked reductases, N-terminal domain 0.0000000527
Further Details:      
 
Domain Number 2 Region: 221-331
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 2.42e-34
Family L-aminoacid/polyamine oxidase 0.00000161
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000003507   Gene: ENSOARG00000003288   Transcript: ENSOART00000003571
Sequence length 451
Comment pep:known_by_projection chromosome:Oar_v3.1:X:40781769:40812225:-1 gene:ENSOARG00000003288 transcript:ENSOART00000003571 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RIHILTSDSGLQINQKNINSCISQGKSYPFRGSFPSVWNPIAYLDHNNLWRTMDDMGREI
PSDAPWKAPLAEQWDRMTMKELLDKICWTESSKQLAILFVNLCVSAEIHEVSALWFLWYV
KQCGGTTRIFSTSNGGQERKFVGGSGQVSERIMELLGDRVKLERPVIHIDQTGENVLVET
LNHELYEAKYVISAVPPVLGMKIHFNPPLPMMRNQLITRVPLGSVIKSIVYYKEPFWRNM
DYCGSMIIEGEEAPVAYTLDDTKPDGSYPAIIGFILAHKARKLARLTKEERLKKLCDLYA
KVLGSQEALHPVHYEEKNWCEEQYSAGCYTSYFPPGIMTQYGRVLRQPVGRIYFAGTETA
THWSGYMEGAVEAGERAAREILHAMGKIPEDEIWLPEPESVDVPAKPITTTFLQRHLPSV
PGLLKLIGLTTIISATALGYLAHKRGLLVRI
Download sequence
Identical sequences W5NZA9
ENSOARP00000003507

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]