SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000003557 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000003557
Domain Number 1 Region: 480-837
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 1.22e-114
Family PDEase 0.000000241
Further Details:      
 
Domain Number 2 Region: 233-278,305-455
Classification Level Classification E-value
Superfamily GAF domain-like 6.71e-31
Family GAF domain 0.00069
Further Details:      
 
Domain Number 3 Region: 53-247
Classification Level Classification E-value
Superfamily GAF domain-like 3.71e-29
Family GAF domain 0.00044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000003557   Gene: ENSOARG00000003335   Transcript: ENSOART00000003621
Sequence length 855
Comment pep:known_by_projection chromosome:Oar_v3.1:22:14615735:14675927:1 gene:ENSOARG00000003335 transcript:ENSOART00000003621 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGEISQETVEKYLEDNPQFAKDYFNRKLQVEAPSGGAQAPASASFPGRTLAEEAALYLEL
LEALLEEAGSVELAVHRALRRLAQLLRADRCSMFSCRARNGTPEVASKLLDVTPTSRFED
NLVVPDREAVFPLDVGIVGWVAHTKKTFNVPDVKKNSHFSDFMDKQTGYVTRNLLATPIV
MGKEVLAVFMAVNKVDAPEFSKQDEEVFSKYLSFVSIILKLHHTNYLYNIESRRSQILMW
SANKVFEELTDVERQFHKALYTVRTYLNCERYSIGLLDMTKEKEFYDEWPVKLGEVEPYK
GPKTPDGREVIFYKIIDYILHGKEEIKVIPTPPTDHWTLVSGLPTYVAENGFICNMLNAP
ADEYFTFQKGPVDETGWVIKNVLSLPIVNKKEDIVGIATFYNRKDGKPFDEYDENIAETL
TQFLGWSLLNTDTYEKMNKLENRKDIAQEMLMNHTKATPDEIKSILKFKEKLNIDVIEDC
EEKQLVTILKEDLPDPRTADLYEFRFSDLPITEHELIKCGLRLFFEINVVEKFKVPVEVL
TRWMYTVRKGYRAVTYHNWRHGFNVGQTMFTLLMTGRLKKYYTDLEAFAMLAAAFCHDID
HRGTNNLYQMKSTSPLARLHGSSILERHHLEYSKTLLQDESLNIFQNLNKRQYETVIHLF
EVAIIATDLALYFKKRTMFQKIVDACEKMETEEEAVKYVTIDPTKKEIIMAMMMTACDLS
AITKPWEVQSQVALLVANEFWEQGDLERTVLQQQPIPMMDRNKKDELPKLQVGFIDFVCT
FVYKEFSRFHKEITPMLNGLQNNRVEWKSLADEYDEKMKVIEEMKKQEEGNTTEKAVEDS
GGGGDDKKSKTCLML
Download sequence
Identical sequences W5NZF9
XP_004020090.1.66739 ENSOARP00000003557

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]