SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000003571 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000003571
Domain Number 1 Region: 234-384
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 6.25e-26
Family Reprolysin-like 0.01
Further Details:      
 
Domain Number 2 Region: 1155-1219
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000249
Family TSP-1 type 1 repeat 0.0035
Further Details:      
 
Domain Number 3 Region: 1105-1161
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000275
Family TSP-1 type 1 repeat 0.0089
Further Details:      
 
Domain Number 4 Region: 1035-1101
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000445
Family TSP-1 type 1 repeat 0.0046
Further Details:      
 
Domain Number 5 Region: 542-595
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000575
Family TSP-1 type 1 repeat 0.0012
Further Details:      
 
Weak hits

Sequence:  ENSOARP00000003571
Domain Number - Region: 1377-1487
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000129
Family Spermadhesin, CUB domain 0.016
Further Details:      
 
Domain Number - Region: 991-1040
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00693
Family TSP-1 type 1 repeat 0.0084
Further Details:      
 
Domain Number - Region: 1273-1368
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0159
Family Spermadhesin, CUB domain 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000003571   Gene: ENSOARG00000003336   Transcript: ENSOART00000003635
Sequence length 1494
Comment pep:known_by_projection chromosome:Oar_v3.1:3:2469554:2501464:-1 gene:ENSOARG00000003336 transcript:ENSOART00000003635 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIAGSMAPSTLGRCMQGTLTSALFLLSCWALPDPRQQFLQALEPGDVTSYFGPDAAFEDP
PFGSEKPLKDEGGLAGPPCRALCCSLAALGRLFSFCFQPELGLLAASFASELAVSASLWL
LRGPPHPCLPGGRALLAPRPLRWPVLSLRRGEGGPGLLGAAGTGVMRRHRVTRGAEPPPT
AARLPGWAVQPGPRQGTRGPPELNAYPGPRLSALPAPSPGHPPASRLRRWATGHILHLEL
LVAVGPDVQRTHGEETERYVLTNLNMGSELLRDPSLGAQFRVHLVKMVILTQPEDAPKIT
ANITASLLSVCEWSKTVNPEDDTDPGHADLVLYITRFDLELPDGNRQVRGVTQLGGACSS
SWSCLITEDTGFDLGLTIAHEIGHRTVTRSLGLHGVLGAPQPPPPSVLSGETNRNRKPLP
SIGSRNPGQRPTFPLLQNAVVLLCSPPGPLRPSLERCPPGFQTPWRVACKAAAAPTAVAC
TFRGEHLDMCQALSCHTDPLDPSSCSRLLIPLLDGTECGVGKDACSRARCGGLRTGVWVG
VGCLWVWGALGGGGWGGGGGVVTRRRRCDNPRPAFGGRACVGSDLQAEMCNTQACETTQL
EFMSEQCAQTDGEPLHLSPGGSTSFYRWGTATLLSPGNALCRHVCRAVGESFMVRRGDRF
LDGTRCVLGDSQEDGALSLCVSGSCRTFGCDGRMDSGQVRDVCQVCGGDSSTCRPQNGSF
TAGRAREYVTFLTVTPNLTSISVINRRPLFTHLASRAATHAAAGGLGSHSEPTGAPGVLR
AAQRESPAEGPGASREGALQLRPRRARQRGRPCRRPGLEAXSPARPDITFTYFQPEQRRA
WAWAPLRGPCSVSCGAGLRQVTYSCWDQSRSEWVEAAGCAGSRPPEAWSGACTLEPCPPQ
ETDACSSACGADPAVQNTTCMPGADGTGLSATAGPCSADEKPPALEPCVEAACPPSWDQL
DVRSPGQEAASPTGGPRLEALAKHVWTPLAGPCSASCGQGLAELHFVCMDPALRTPVREE
LCDLASKPGSRREACQAAPCPARWRYKLAACSLSCGGGVAQRILYCARAHGEDTDEEILP
DTQCQGLPRPEQQEACSPGPCPPRWKVTSLGPCSASCGLGTATRSVACVRLDRGQDTEVD
RAACAGLVRPQASIPCIVADCAYRWHVSAWTQCSVSCGEGIQLRHDACLGPRARVPVPAD
FCQHLPKPVTVRGCQAGPCTGQGTASPAPHEEATAPGQTAAATAASPEWAQPHTRLLSPA
RGHLPRPQESPVETSVCGRQHLEPTGIIDMRGTTRPDCAAAIGRPLGEVVTLRVLEGCPG
EMLLLWGRLVWRKMCGKPAGMAFSSQANTLLVRQRLVRPGGGVLLRYSSQPAPGAFHRGC
DTQLFGPRGEILSPSMSPGGRNVGGCRIFIDVAPRARIAIHALTVDSGTRAEGTDASYIL
IRDIHSLRTTAFRGQQTLYWESEGSQAEMEFSQGFLEAHASLRGQYWTLHTRAR
Download sequence
Identical sequences W5NZH3
ENSOARP00000003571

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]