SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000003880 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000003880
Domain Number 1 Region: 215-507
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.31e-75
Family WD40-repeat 0.0000000000672
Further Details:      
 
Domain Number 2 Region: 101-213
Classification Level Classification E-value
Superfamily F-box domain 5.89e-27
Family F-box domain 0.00000102
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000003880   Gene: ENSOARG00000003635   Transcript: ENSOART00000003948
Sequence length 531
Comment pep:known_by_projection chromosome:Oar_v3.1:16:3710065:3801550:-1 gene:ENSOARG00000003635 transcript:ENSOART00000003948 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCALSCLQSMPSVRCLQNTSVMEDQNEDESPKKNTLWQISNGTSSVIVSRKRPSEGNYQK
EKDLCIKYFDQWSESDQVEFVEHLISRMCHYQHGHINSYLKPMLQRDFITALPEQGLDHI
AENILSYLDARSLCAAELVCKEWQRVISEGMLWKKLIERMVRTDPLWKGLSERRGWDQYL
FKNRPTDGPPNSFYRSLYPKIIQDIETIESNWRCGRHNLQRIQCRSENSKGVYCLQYDDE
KIISGLRDNSIKIWDKTSLECLKVLTGHTGSVLCLQYDERVIVTGSSDSTVRVWDVNTGE
VLNTLIHHNEAVLHLRFSNGLMVTCSKDRSIAVWDMASATDITLRRVLVGHRAAVNVVDF
DDKYIVSASGDRTIKVWSTSTCEFVRTLNGHKRGIACLQYRDRLVVSGSSDNTIRLWDIE
CGACLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVWDLQAALDPRAPASTLCLRTLVEH
SGRVFRLQFDEFQIISSSHDDTILIWDFLNVPPSAQNETRSPSRTYTYISR
Download sequence
Identical sequences A0A1D5QPH5 A0A1U7UDB7 A0A2K5S0Q8 A0A2K6RBW4 I3LGM0 W5P0D2
XP_005265913.1.92137 XP_005619267.1.84170 XP_006104193.1.53796 XP_006864875.1.41390 XP_007171424.1.59432 XP_007465599.1.90284 XP_008063876.1.4292 XP_008253608.1.1745 XP_010344954.1.74449 XP_011738366.1.29376 XP_011906396.1.92194 XP_011906397.1.92194 XP_012316556.1.9421 XP_012415592.1.4749 XP_012577677.1.23501 XP_014996885.1.72884 XP_015420575.1.95426 XP_018883774.1.27298 XP_019491505.1.44202 XP_019801448.1.83887 XP_020932777.1.46622 ENSOARP00000003880

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]