SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000004002 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000004002
Domain Number 1 Region: 135-400
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.26e-58
Family Eukaryotic proteases 0.0000929
Further Details:      
 
Domain Number 2 Region: 87-149
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000764
Family Complement control module/SCR domain 0.0028
Further Details:      
 
Domain Number 3 Region: 30-88
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000556
Family Complement control module/SCR domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000004002   Gene: ENSOARG00000003744   Transcript: ENSOART00000004073
Sequence length 416
Comment pep:novel chromosome:Oar_v3.1:14:38339927:38344098:-1 gene:ENSOARG00000003744 transcript:ENSOART00000004073 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CSVLPAVITLLLCGQLLAVETGSEAAAGSCPKAPEIANGHVEYSVRYQCDKYYKLRAGNG
VYTFNNKQWINKDIGPQLPECEEDVSCPEAPKIKNGYVEYSVSYQCKTYYKLRTDGDGVY
TFNSKKQWINKNVGQQLPECEAVCGKPKHPVDQTQRIIGGSLDAKGSFPWQAKMVSHHNL
ISGATLINEQWLLTTAKNLYLGHTSDKKAKDITPTLRLYVGKNQLVEVEKVVLHPDHSKV
DIGLIKLRQKVPVNDKVMPICLPSKDYVAVDRVGYVSGWGRNENFNFTGHLKYVMLPVAD
QDKCVKHYEGNAAPKNKTATSPVGVQPILNENTFCVGLSKYQEDTCYGDAGSAFVVHDQE
DDTWYAAGILSFDKSCAVAEYGVYVKVTSILDWVRKTIANKKQLPERTRGKLHRSG
Download sequence
Identical sequences W5P0Q4
ENSOARP00000004002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]