SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000004043 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000004043
Domain Number 1 Region: 376-480
Classification Level Classification E-value
Superfamily SEA domain 7.85e-20
Family SEA domain 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000004043   Gene: ENSOARG00000003788   Transcript: ENSOART00000004114
Sequence length 588
Comment pep:known_by_projection chromosome:Oar_v3.1:1:103953269:103957605:-1 gene:ENSOARG00000003788 transcript:ENSOART00000004114 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTPDIQAPFLSLLLLFQVLTVANVTMLTASVSTSPNSTVQVSSTQSSPTSSPTKETSWST
TTSHGGTLTTTSSPAPSPTASPGHDGASTPTSSPAPSPAASPGHDGALSLTGSPAPSPTA
SPGHGGTLTTTSSPAPSPTASPGHDGASTPTSSPAPSPAASSSHDGALSLTGSPAPSPPA
SPGHGGTLTTTSSPAPSPTASPGHGGTLTTTSSPAPSPTASPGHDGASTPTSSPAPSPAA
SAHSSHDGALTTTGSPAPSPAASPGHDSVPPRATSPAPSPAASPGQHAASSPTSSDISSV
TTSSMSSSMVTSAHKGTSSRATTTPVSKGTPSSVPSSETAPTAASHSTRTAAASTSPSTA
LSTASHPKTSQQLSVQVSLFFLSFRITNLQFNSSLENPQTSYYQELQRSILDVILQTYKQ
RDFLGLSEIKFRPGSVLVDLTLAFREGTTAELVKAQFSQLEAHAANYSLTISGVSVRDAQ
FPSSAPSASGVPGWGIALLVLVCVLVALAIIYLIALVVCQCGRKKCEQLDIFPTLGAYHP
MSEYSAYHTHGRFVPPGSTKRSPYEEVSAGNGGSNLSYTNLAATSANL
Download sequence
Identical sequences W5P0U4
ENSOARP00000004043

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]