SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000004066 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000004066
Domain Number 1 Region: 1-301
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.2e-85
Family Protein kinases, catalytic subunit 0.00000249
Further Details:      
 
Domain Number 2 Region: 316-682
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 2.01e-69
Family Regulator of chromosome condensation RCC1 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000004066   Gene: ENSOARG00000003806   Transcript: ENSOART00000004138
Sequence length 693
Comment pep:known_by_projection chromosome:Oar_v3.1:11:19779100:19786873:1 gene:ENSOARG00000003806 transcript:ENSOART00000004138 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKYERIRVVGRGAFGIVHLCLRKADQKLVIIKQIPVEQMTKEERQAAQNECQVLKLLNH
PNVIEYYENFLEDKALMIAMEYAPGGTLAEFIQKRCNSLLEEETILHFFVQILLALHHVH
SHLILHRDLKTQNILLDKHRMVVKIGDFGISKILSSKSKAYTVVGTPCYISPELCEGKPY
NQKSDIWALGCVLYELASLKRAFEAANLPALVLKIMSGTFAPISDRYSPELRQLVLSLLS
LEPAQRPPLSHIMAQPLCIRALLNLHTDLGSVRMRRAEKPLATGPPMTPGSTGSRTTSAA
PPAPGVPRGPARPAIPPPLSSVYTWGGGLSAPLRLPMLNTEVVQVAAGRTQKAGVTRSGX
PPGAGGGALLPGAVEQQQPQFVSRFLEGQSGVTIKHVACGDLFTACLTDRGIIMTFGSGS
NGCLGHGGLNDISQPTIVEALLGYEMVQVACGASHVLALSTERELFAWGRGDGGRLGLGT
RESHSCPQQVPMPPGQEAQRAICGIDSSMILTVPGRALACGSNRFNKLGLDHLSLGEEPA
PHQQVEEALNFTPLGSAPLDREPLLSVDLGTAHSAAVTASGDCYTFGSNQHGQLGTNARR
VSRAPCQVQGLQGIKIAMVACGDAFTVAIGAEGEVYSWGKGARGRLGRRDEDAALPRPVQ
LDETHPYTVTSVSCCHGNTLLAIRPVTDEPVPP
Download sequence
Identical sequences W5P0W7
ENSOARP00000004066

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]