SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000004091 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000004091
Domain Number 1 Region: 37-239
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.11e-48
Family Reprolysin-like 0.0022
Further Details:      
 
Domain Number 2 Region: 331-386
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000129
Family TSP-1 type 1 repeat 0.00034
Further Details:      
 
Domain Number 3 Region: 746-799
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000209
Family TSP-1 type 1 repeat 0.003
Further Details:      
 
Domain Number 4 Region: 679-746
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000536
Family TSP-1 type 1 repeat 0.0036
Further Details:      
 
Domain Number 5 Region: 627-684
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000458
Family TSP-1 type 1 repeat 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000004091   Gene: ENSOARG00000003830   Transcript: ENSOART00000004163
Sequence length 982
Comment pep:known_by_projection chromosome:Oar_v3.1:5:1862751:1966978:1 gene:ENSOARG00000003830 transcript:ENSOART00000004163 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GVSPDSLDSLSRALGVLEERVNSSRRRVRRHAADDDYNIEVLLGVDDSVVQFHGKEHVQK
YLLTLMNIVNEIYHDESLGAHINVVLVRIILLSHGKSMSLIEIGNPSQSLENVCRWAYLQ
QKPDTDHDEYHDHAIFLTRQDFGPSGMQGYAPVTGMCHPVRSCTLNHEDGFSSAFVVAHE
TGHVLGMEHDGQGNRCGDEVRLGSIMAPLVQAAFHRFHWSRCSQQELSRYLHSYDCLRDD
PFTHDWPALPQLPGLHYSMNEQCRFDFGLGYMMCTAFRTFDPCKQLWCSHPENPYFCKTK
KGPPLDGTMCAPGKHCFKGHCIWLTPDILKRDGNWGAWSPFGSCSRTCGTGVKFRTRQCD
NPHPANGGRTCSGLAYDFQLCNAQDCPDALADFREEQCRQWDLYFEHGDAQHHWLPHEHR
DAKERCHLYCESKETGEVVSMKRMVHDGTRCSYKDAFSLCVRGDCRKVGCDGVIGSSKQE
DKCGVCGGDNSHCKVVKGTFTRAPKKLGYIKMFEIPAGARHLLIQEADTTSHHLAVKNLE
TGKFILNEENDVDPNSKTFIAMGVEWEYRDEDGRETLQTMGPLHGTITVLVIPEGDARIS
LTYKYMVHEDSLNVDDNNVLEDDSVGYEWALKKWSPCSKPCGGGSQFTKYGCRRRLDHKM
VHRGFCDSVSKPKAIRRTCNPQECSQPVWVTGEWEPCSRSCGRTGMQARSVRCVQPLHNN
TTRSVHTKHCNDARPEGRRACNRELCPGRWRAGSWSQCSVTCGNGTQERPVLCRTADDSF
GVCREERPETARICRLGPCPRNTSDPSKKSYVVQWLSRPDPNSPVQETSSKGRCQGDKSV
FCRMEVLSRYCSIPGYNKLCCKSCKLHDNLTDVDDRAEPPSGKHNDIEELVPTLPVPTLV
MEVQPPPGVPLEVPLNTSSTNATEDHPETNAVDVPYKIHGLEDEVQPPNLIPRRPSPYEK
TRNQRIQELIDEMRKKEMLGKF
Download sequence
Identical sequences W5P0Z2
ENSOARP00000004091

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]