SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000004255 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000004255
Domain Number 1 Region: 1615-1860
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.35e-54
Family Ankyrin repeat 0.0000000653
Further Details:      
 
Domain Number 2 Region: 994-1135
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000188
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 3 Region: 686-813
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000738
Family Growth factor receptor domain 0.0065
Further Details:      
 
Domain Number 4 Region: 458-587
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000204
Family Growth factor receptor domain 0.0094
Further Details:      
 
Domain Number 5 Region: 276-399
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000549
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 6 Region: 155-324
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000769
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 7 Region: 810-925
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000314
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 8 Region: 395-438
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000032
Family EGF-type module 0.0059
Further Details:      
 
Domain Number 9 Region: 965-1008
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000062
Family EGF-type module 0.012
Further Details:      
 
Domain Number 10 Region: 124-167
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000201
Family EGF-type module 0.015
Further Details:      
 
Domain Number 11 Region: 1133-1183
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000381
Family EGF-type module 0.013
Further Details:      
 
Domain Number 12 Region: 61-95
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000134
Family EGF-type module 0.0031
Further Details:      
 
Domain Number 13 Region: 623-659
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000286
Family EGF-type module 0.011
Further Details:      
 
Domain Number 14 Region: 1267-1299
Classification Level Classification E-value
Superfamily Notch domain 0.00000301
Family Notch domain 0.0065
Further Details:      
 
Domain Number 15 Region: 937-973
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000304
Family EGF-type module 0.033
Further Details:      
 
Domain Number 16 Region: 3-41
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000342
Family EGF-type module 0.036
Further Details:      
 
Domain Number 17 Region: 580-620
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000109
Family EGF-type module 0.01
Further Details:      
 
Domain Number 18 Region: 661-698
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000114
Family EGF-type module 0.021
Further Details:      
 
Domain Number 19 Region: 1319-1342
Classification Level Classification E-value
Superfamily Notch domain 0.0000615
Family Notch domain 0.0049
Further Details:      
 
Weak hits

Sequence:  ENSOARP00000004255
Domain Number - Region: 1226-1259
Classification Level Classification E-value
Superfamily Notch domain 0.000471
Family Notch domain 0.0016
Further Details:      
 
Domain Number - Region: 100-128
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00148
Family EGF-type module 0.01
Further Details:      
 
Domain Number - Region: 1176-1210
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0111
Family EGF-type module 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000004255   Gene: ENSOARG00000003966   Transcript: ENSOART00000004330
Sequence length 2053
Comment pep:known_by_projection chromosome:Oar_v3.1:5:7691090:7726339:1 gene:ENSOARG00000003966 transcript:ENSOART00000004330 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
APPCLDGSPCVNGGRCTQLPSREAACLCPPGWVGERCQLEDPCHSCRGRGGKSSSAHGDH
ECRMGGPCRHGGTCLNTPGSFRCQCPGGYTGPLCESPAAPCAPSPCRYDCACLPGFEGQN
CEVNVDDCPGHRCLNGGTCVDGVNTYNCQCPPEWTGQFCTEDVDECQLQPNACHNGGTCF
NTLGGHSCVCVNGWTGESCSQNIDDCATAVCFHGATCHDRVASFYCACPMGKTGLLCHLD
DACVSNPCHEDAICDTNPVNGRAICTCPPGFTGGACDQDVDECSIGANPCEHLGRCVNTQ
GSFLCQCGRGYTGPRCETDVNECLSGPCRNQATCLDRIGQFTCICMAGFTGTYCEVDMDE
CQSSPCVNGGVCKDRVNGFSCTCPSGFSGAMCQLDVDECASTPCRNGAKCVDQPDGYECR
CAEGFEGTVCERNVDDCSPDPCHHGRCVDGIASFSCACAPGYTGMRCESQVDECRSQPCR
HGGKCLDLVDKYLCRCPPGTTGVNCEVNTDDCASNPCTFGVCRDGINRYDCVCQPGFTGP
LCNVEINECASNPCGEGASCVDGENGFRCLCPPGSLPPLCLPPSHPCAQEPCSHGVCHDA
PGGFRCVCEPGWSGPQCSQSLTRDACESHPCRAGGTCTSDGMGFRCTCPPGIQGHQCELL
SPCTPNPCEHGGYCESAPGQLAVCSCTPGWQGPRCQQDVDECASPSPCGPHGTCTNLAGS
FSCTCHEGYSGPSCDQDIDDCDPNPCLNGGSCQDGVGSFSCSCLPGFAGSRCARDVDECL
SSPCGSGTCTDHVASFTCTCPPGYGGDLPDCSPSSCFNGGTCVDGVNSFTCLCRPGYTGT
HCQHEADPCLSRPCMHGGVCTAAHPGFHCACPDGFTGAQCQTLVDWCSRSPCQNGGRCAR
TGASFYCLCPPGWSGRLCDIRSLPCREAAAQIGVPTEQLCQAGGQCVDKDSSHYCVCPEG
HTGSHCEQEMDPCLAQPCQHGGTCRGYVGGYVCECPAGYTGDNCEDDVDECASQPCQHGG
ICIDLMAHYLCSCPPGTLGVLCEINEDDCGPGPALDLGPRCLHNGTCVDLVGGFRCTCPP
GYTGLRCEGDINECRPGACHAAHTRDCLQDPGGGFRCLCHPGFTGPRCQTVLSPCESQPC
QHGGQCRPSPGPGGVLTFSCHCIPPFWGPRCERVARSCRELQCPVGVPCQQTVRGPRCAC
PPGLSGPACRGSRGSPPGAAHASRPRASCEAKSGDKNCDRECNSPGGGWGCGWDGGDCSL
SVSDPWRQCAALQCWLLFNNSRCDPACSSPACLYDNFDCRAGGRERTCNLPVFPFLCPAD
HFADGRCDQGCNTEECGWDGLDACGYIPVLCSLRSLCVLTVLLPPEELLRSSADFLQRLS
GILRTSLRFRLDENGQAMVFPYHRPGPGAESRNRRELAPEVIGSPVMFSLISLLRKCPVC
GSAFLVVHTESYNTYNTYSRRAPPPDPFLHPSPSLNPLILCSMSSNTTSGSNLPTFFVLI
VLIKMKKREAEGAETEGDPGLGVLGILKKEKVWDIDALGMKNMAKGESLMGEVATDWMDT
ECPEAKRLKVEEPGVGTEDAVDCRQWTQHHLVAADIRVAPAMALTPPQGDADADGMDVNV
RGPDGFTPLMLASFCGGALEPIPTEEDEAEDTSASIISDLICQGAQLGARTDRTGETALH
LAARYARADAAKRLLDAGADTNAQDHSGRTPLHTAVTADAQGVFQILIRNRSTDLDARMA
DGSTALILAARLAVEGMVEELIASHADVNAVDELGKSALHWAAAVNNVEATLALLKNGAN
KDMQDSKEETPLFLAAREGSFEAAKLLLDHFANREITDHLDRLPRDVAQERLHQDIVRLL
DQPSGPRSPPGPHGLGPLLCPPGAFLPGLKVAQSGAKKSRRPPGKAGLGPQGTRGRGKKL
TLACPGPLADSSVTLSPVDSLDSPRPFGGPPASPGGFPHGSPPKARFLRVPSEHPYLTPS
PESPEHWASPSPPSLSDWSDSTPSPATATGASATAAGSLSAQPLPFSLTPPLGSCGFHLG
AKPSGSPADPLLL
Download sequence
Identical sequences W5P1F6
ENSOARP00000004255

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]