SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000004261 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSOARP00000004261
Domain Number - Region: 492-526
Classification Level Classification E-value
Superfamily F-box domain 0.0353
Family F-box domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000004261   Gene: ENSOARG00000003989   Transcript: ENSOART00000004336
Sequence length 657
Comment pep:novel chromosome:Oar_v3.1:23:46889775:46891748:-1 gene:ENSOARG00000003989 transcript:ENSOART00000004336 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PREAPQEEAAMEGDGRAHLADRSGRSRGREHRQQQHRHPSEPARPHHESCGRERDEDRRQ
CCRGSPGYSSARAYCGYRRSPPPSTRPRLMSGDRHRRPSEVYVVQRGPEGGPYDAPRARL
GFSQDHGLCAPHRREAGSLSWGYQSPHDDKHPLGAKEYEKSSTLTSQKSVLASSREESPR
PVPSDRAKENPPSTSVKEEERRRRGIQFSPSFGHTSDFKKQKQEDSEKTKPDKNKQSLNR
LDITEGTKGLLPMVKKKATDNQKIQEGKVRPPHLNGKPDGSLPEVEETDMDNECKPPTMF
FHSFLNQDQPREEKKKITKTSATALEEKEPKKNDSSQNLDLVQELPEVNENRSEKQQPSG
NVWAKLEKVPIDAPVWPDLPLPRISAKYHPLPASRLMSSFRPKQKALSSPQKVEEVGFTG
CRMNSKMQVFSGSKCAYLAKMMTLRQQCIWVLKNNINSIFKVGGVPYSVLEPILKSCAPD
QLYRIEKYNHTLVQETDQLWKIHCHQNFRKERPQEHESWREMYMRLQDAQEQRLRALTVN
IQTAHANKPKGRQAKMILLNSLAQPLSDVQRRRQFETQEAAVPEKVKIKPAPYPRETSHT
PSSSNGLNLTHEKPAHTCSSTTSTHLPQVVNGRKPVKKIAPMMAKTIKDFKNRFSRR
Download sequence
Identical sequences W5P1G2
ENSOARP00000004261

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]