SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000004320 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000004320
Domain Number 1 Region: 41-269,368-514
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.87e-63
Family FAD-linked reductases, N-terminal domain 0.00000000000306
Further Details:      
 
Domain Number 2 Region: 270-368
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 1.73e-37
Family Electron transfer flavoprotein-ubiquinone oxidoreductase-like 0.00000083
Further Details:      
 
Domain Number 3 Region: 516-615
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 1.24e-28
Family ETF-QO domain-like 0.00000211
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000004320   Gene: ENSOARG00000004036   Transcript: ENSOART00000004396
Sequence length 617
Comment pep:known_by_projection chromosome:Oar_v3.1:17:40060886:40102313:-1 gene:ENSOARG00000004036 transcript:ENSOART00000004396 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQVLLARLACPVYQCFHAIKIKKNYLPLCAIRWSSTSVVPRITTHYTVYPRDQDKRWEGV
NMERFAEEADVVIVGAGPAGLSAAARLKQLAAQHEKDIRVCLVEKAAQIGAHTLSGACLD
PRALQELFPDWKEKGAPLNTPVTEDRFGILTEKYRIPVPILPGLPMNNHGNYIVRLGHLV
SWMGEQAEALGVEVYPGYAAAEVLFHEDGSVKGIATNDVGIQKDGAPKTTFERGLELHAK
VTIFAEGCHGHLAKQLYRKFDLRANCEPQTYGIGLKELWVIDEKKWKPGRVDHTVGWPLD
RHTYGGSFLYHLNEGEPLVALGFVVGLDYQNPYLSPFREFQRWKHHPSIQPTLEGGKRIA
YGARALNEGGLQSIPKLTFPGGLLIGCSPGFMNVPKIKGTHTAMKSGILAAESIFNQLTN
ENLQSKTIGLDVTEYEDNLKKSWVWKELYSVRNIRPSCHSILGVYGGMIYTGIFYWIFRG
MEPWTLKHKGSDSDKLKPAKDCTPIEYPKPDGQISFDLLSSVALSGTNHEHDQPAHLTLK
DDSVPVNRNLSIYDGPEQRFCPAGVYEFVPVEQGDGFRLQINAQNCVHCKTCDIKDPSQN
INWVVPEGGGGPAYNGM
Download sequence
Identical sequences W5P1M1
ENSOARP00000004320 XP_004017330.1.66739 XP_012003574.1.54773

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]