SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000004493 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000004493
Domain Number 1 Region: 199-317
Classification Level Classification E-value
Superfamily Retrovirus capsid protein, N-terminal core domain 2.59e-26
Family Retrovirus capsid protein, N-terminal core domain 0.00021
Further Details:      
 
Domain Number 2 Region: 6-100
Classification Level Classification E-value
Superfamily Retroviral matrix proteins 1.24e-23
Family MMLV matrix protein-like 0.00082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000004493   Gene: ENSOARG00000004203   Transcript: ENSOART00000004573
Sequence length 368
Comment pep:novel chromosome:Oar_v3.1:3:71104383:71105721:1 gene:ENSOARG00000004203 transcript:ENSOART00000004573 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGGNESKATVLECLMKNFKKGFGGDYGVKMTPNHLHIPCEVEWPPVGVRWPPEDTTNLKI
VEAVNAVITGEPGHPDQYPYIDSWLGLAQDTPPWMRLCIQKGKGNILMAQKLTDDKKEIL
QDLDGDDLPPPPYWMMMHPPPSAPLEPWPGGVPAEAAALLPALPGIIEPPFGQAPIPVVE
TSGQCHQDSTSARPPRLYPPLTYYYQPFSSTDTLNWQRHSPPMGEPQAMIRLMETHCATW
DDIIQLLVSLFSTEERHRILTEARKWLNEMVPEGTTNPQQWAELATPDERPNDYNTEEER
GHLERHSVAILQGLKRAMNMAKPSEVIQREIESPSEFYETVLYTNNPESLDPENIGSQMV
INAAFVSQ
Download sequence
Identical sequences W5P244
ENSOARP00000004493

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]