SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000004593 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000004593
Domain Number 1 Region: 28-97
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000149
Family Growth factor receptor domain 0.0034
Further Details:      
 
Domain Number 2 Region: 197-240
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000222
Family TSP-1 type 1 repeat 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000004593   Gene: ENSOARG00000004293   Transcript: ENSOART00000004674
Sequence length 253
Comment pep:known_by_projection chromosome:Oar_v3.1:13:72677323:72689402:1 gene:ENSOARG00000004293 transcript:ENSOART00000004674 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRGTFQTHLLAFSLLCLLSKVCAQLCPTPCACPWPPPRCPLGVPLVLDGCNCCRVCARRL
GEPCDHLHVCDPSQGLVCQPGAGPGGRGAVCLCKQEGRGVSERNKESELFYQCLSCAESC
ARRCRCEDGGFTCVPLCSEDVRLPSWDCPHPRRVEVPGKCCPEWVCDQGGGLGVQPLPAQ
GPQFSGFVAPPAPGVSCPEWSTAWGPCSTTCGLGVATRVSNQNRFCRLETQRRLCLLGPC
PPARGHGPKEQSL
Download sequence
Identical sequences W5P2E4
ENSOARP00000004593

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]