SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000004595 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000004595
Domain Number 1 Region: 28-101
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000534
Family Growth factor receptor domain 0.0034
Further Details:      
 
Domain Number 2 Region: 192-235
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000209
Family TSP-1 type 1 repeat 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000004595   Gene: ENSOARG00000004293   Transcript: ENSOART00000004676
Sequence length 248
Comment pep:known_by_projection chromosome:Oar_v3.1:13:72677323:72689402:1 gene:ENSOARG00000004293 transcript:ENSOART00000004676 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRGTFQTHLLAFSLLCLLSKVCAQLCPTPCACPWPPPRCPLGVPLVLDGCNCCRVCARRL
GEPCDHLHVCDPSQGLVCQPGAGPGGRGAVCLCARECPMTGTEFGGWELGKPQLRQKRCR
CEDGGFTCVPLCSEDVRLPSWDCPHPRRVEVPGKCCPEWVCDQGGGLGVQPLPAQGPQFS
GFVAPPAPGVSCPEWSTAWGPCSTTCGLGVATRVSNQNRFCRLETQRRLCLLGPCPPARG
HGPKEQSL
Download sequence
Identical sequences W5P2E6
ENSOARP00000004595

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]