SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000004599 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000004599
Domain Number 1 Region: 164-381
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 2.99e-46
Family Reprolysin-like 0.0004
Further Details:      
 
Domain Number 2 Region: 751-810
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000119
Family TSP-1 type 1 repeat 0.0042
Further Details:      
 
Domain Number 3 Region: 876-927
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000654
Family TSP-1 type 1 repeat 0.0047
Further Details:      
 
Domain Number 4 Region: 927-979
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000301
Family TSP-1 type 1 repeat 0.0039
Further Details:      
 
Domain Number 5 Region: 810-846
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000471
Family TSP-1 type 1 repeat 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000004599   Gene: ENSOARG00000004292   Transcript: ENSOART00000004680
Sequence length 1028
Comment pep:known_by_projection chromosome:Oar_v3.1:5:14844882:14866696:-1 gene:ENSOARG00000004292 transcript:ENSOART00000004680 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PSPREWTFYKVAAPSTHFLLNLTHSPRLLAGHVSVEYWTREGLAWQRAARPHCLSRHFEA
SSSHVAISTCGGLHGLIVADEEEYLIEPLHGGPKGRRGPEESGPHVVYKRSSLRHPHLDT
ACGVRDEKPWKGRPWWLRTLKPPPARPLGNETERGQPGLKRSVSRERYVETLVVADKMMV
AYHGRRDVEQYVLAIMNIVAKLFQDSSLGNIVNILVTRLILLTEDQPTLEITHHAGKSLD
SFCKWQKSIVNRSGHGNAIPENGVANHDTAVLITRYDICIYKNKPCGTLGLAPVGGMCER
ERSCSVNEDIGLATAFTIAHEIGHTYGRRRAGGGGGGGHTWLGCRAAHITMKTTPFVWSS
CSRDYITSFLDSGLGLCLNNRPPRLYPTVAPGQAYDADEQCRFQHGVKSRQCKYGEVCSE
LWCLSKSNRCITNSIPAAEGTLCQTHTIDKGWCYKRVCVPFGSRPEGVDGAWGPWPGQPS
GPSARRGWRPLPPIPPAPFLSCPPPASRPTIGGKYCLGERRRHRSCNTEDCPPGSQDFRE
MQCSEFDSVPFRGKFYTWKTYRGGGVKACSLTCLAEGFNFYTERAAAVVDGTPCRPDTVD
ICVSGECKHVGCDRVLGSDLREDKCRVCGGDGSACETIEGVFSPALLGTGYEEVVWIPKG
SVHIFIQDLNLSLSHLALKGDQESLLLEGLPGPPQPHRTTFQLRQGPDQSQSLEALGPIN
ASLIVMTVLTQTELPALRYRFNAPIARDALPPYSWHYAPWTKCSAQCAGGSQVQAVECRN
QLDSSAVAPHHCSAHSKLPKRQRACNTEPCPPDWVVGNWSRCSRSCDAGVRSRSVVCQRR
VSAAEGKGRHGRAGVAPHRAPPHQAPPHPLALVGPRDWSKCTPSCGPGLRLRVVLCKSAD
HRATLPPAHCQPAAKPPATMRCNLRRCPPARWVAGEWGECSAQCGFGQQQRPVRCSSHTG
QPSRECAEALRPPATQQCEAKCDSAPPGDGLEECKDVNKVAYCPLVLKFQFCSRAYFRQM
CCKTCQGR
Download sequence
Identical sequences W5P2F0
ENSOARP00000004599

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]