SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000004682 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000004682
Domain Number 1 Region: 3-70
Classification Level Classification E-value
Superfamily POZ domain 1.52e-23
Family BTB/POZ domain 0.0000474
Further Details:      
 
Domain Number 2 Region: 81-129
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 0.0000000000000301
Family Skp1 dimerisation domain-like 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000004682   Gene: ENSOARG00000004377   Transcript: ENSOART00000004763
Sequence length 140
Comment pep:novel chromosome:Oar_v3.1:8:81643484:81643959:1 gene:ENSOARG00000004377 transcript:ENSOART00000004763 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSIKLQSSDGEIIEVDIEIAKQSVTLKTTLEDLGMSDEGDDDPVPLPNVNAAILEKVIQ
WCTHHKDDPPPEDDENKGRRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKVLLDVTCK
AWILLKKGKPRYTKRTSGVR
Download sequence
Identical sequences W5P2N2
ENSOARP00000004682

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]