SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000004711 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSOARP00000004711
Domain Number - Region: 76-110
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 0.0978
Family Choline/Carnitine O-acyltransferase 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000004711   Gene: ENSOARG00000004402   Transcript: ENSOART00000004792
Sequence length 113
Comment pep:known_by_projection chromosome:Oar_v3.1:8:81686783:81693575:-1 gene:ENSOARG00000004402 transcript:ENSOART00000004792 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LETVYVYPETAFVVDEVSNIVKEAIESAIGGNAYQHSKVNQWTTNVVEQTLSQLTKLGKP
FKYIVTCVIMQKNGAGLHTASSCFWDSATDGSCTVRWENKTMYCIVSAFGLSI
Download sequence
Identical sequences W5P2R1
ENSOARP00000004711

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]