SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000004823 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000004823
Domain Number 1 Region: 5-553
Classification Level Classification E-value
Superfamily SIS domain 4.45e-233
Family Phosphoglucose isomerase, PGI 0.00000000000000185
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000004823   Gene: ENSOARG00000004502   Transcript: ENSOART00000004904
Sequence length 557
Comment pep:known_by_projection chromosome:Oar_v3.1:14:44074243:44101225:1 gene:ENSOARG00000004502 transcript:ENSOART00000004904 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAALPQNPQFKKLKTWYEQHGPDLNLRRLFEGDRDRFNRFSLNLNTNHGHILVDYSKNLV
TETVMQMLVDLAKSRGVEAARERMFTGEKINFTEDRAVLHVALRNRSNTPILVDGKDVMP
EVNRVLEKMKSFCQRVRSGEWKGYSGKAITDVINIGIGGSDLGPLMVTEALKPYSSEGPR
VWFVSNIDGTHIAKTLASLNPESSLFIIASKTFTTQETITNAETAKEWFLLSARDPSAVA
KHFVALSTNTAKVKEFGIDPQNMFEFWDWVGGRYSLWSAIGLSIALHVGFDNFEQLLSGA
HWMDQHFRTTPLEKNAPVLLALLGIWYINCFGCETHAMLPYDQYLHRFAAYFQQGDMESN
GKYITKSGVRVNHQTGPIVWGEPGTNGQHAFYQLIHQGTKMIPCDFLIPVQSQHPIRNGL
HHKILLANFLAQTEALMRGKSTEEARKELQAAGRSPEDFEKLLPHKVFEGNRPTNSIVFT
KLTPFILGALIAMYEHKIFVQGIIWDINSFDQWGVELGKQLAKKIEPELDGSSPVTSHDS
STNGLINFIKQEREARS
Download sequence
Identical sequences W5P323
ENSOARP00000004823 XP_004015200.1.66739

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]