SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000004838 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000004838
Domain Number 1 Region: 461-715
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.41e-72
Family Eukaryotic proteases 0.0000000148
Further Details:      
 
Domain Number 2 Region: 38-155
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.09e-29
Family Spermadhesin, CUB domain 0.0000976
Further Details:      
 
Domain Number 3 Region: 206-318
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.76e-28
Family Spermadhesin, CUB domain 0.0000349
Further Details:      
 
Domain Number 4 Region: 390-470
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000153
Family Complement control module/SCR domain 0.0000248
Further Details:      
 
Domain Number 5 Region: 322-393
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000417
Family Complement control module/SCR domain 0.0000219
Further Details:      
 
Domain Number 6 Region: 155-205
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000196
Family EGF-type module 0.00065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000004838   Gene: ENSOARG00000004515   Transcript: ENSOART00000004920
Sequence length 719
Comment pep:known_by_projection chromosome:Oar_v3.1:3:207326981:207339991:1 gene:ENSOARG00000004515 transcript:ENSOART00000004920 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ISLRSRMDQEENAQRWLLYLLLPVLFFGVGGAIPTPQRLYGEVMSPLFPKPYPNNFERTT
VITVPTGYRVKLVFWQFDLEPSDGCFYDYVKISADKKTMGRFCGQLGTPLGNPPGRKEFM
SQGNKMLLTFHSDFSNEDNGTVMFYKGFLAYYQAVDLDECALQLNSVEEDPPPRCQHLCH
NYVGGYFCSCRPGYELQQDGRSCQAECSSELFTEPSGYISSLEYPGPYPPDLRCNYSIRV
ERGHTLHLQFLEPFEIDDHQQIHCPYDQLQIYVSGRNIGEFCGKQRPERIDAQSNSVDLL
FFTDESGDSRGWKLYYTSEVIKCPQPKTLDAFTIIQDLQPQYQYRDYFIATCKKGYELVE
GNKALLSFTAVCQDDGTWHRAMPRCRIKDCGQPRSLPNGAFNYTTREGVNTYEARIQYYC
HEPFYKMHTKDGTSESERGLYTCTAQGIWKNELVGEKMPRCLPVCGKPVHPVEQRQRIIG
GQKAKLGNFPWQAYTNIHGPGGGALLGDRWILTAAHTINPKDHEAQGPPNLDVFLGHVNV
EDITKLSNHPVRRVIIHPDYRQEESHNFEGDLALLELENSVTLGPNLLPICLPDNETLYD
PGLMGYVSGFGIMEERISHNLRFVRLPVARRELCERWLRQKNRNDVFSENMFCAGNPATR
QDSCQGDSGGVFAVSDKQNDRWVATGIVSWGIGCGEGYGFYTNLLNYVDWIKKVMEVED
Download sequence
Identical sequences W5P338
ENSOARP00000004838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]