SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000004994 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000004994
Domain Number 1 Region: 437-693
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.09e-72
Family Eukaryotic proteases 0.0000000661
Further Details:      
 
Domain Number 2 Region: 31-141
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.27e-30
Family Spermadhesin, CUB domain 0.0000011
Further Details:      
 
Domain Number 3 Region: 186-299
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.09e-23
Family Spermadhesin, CUB domain 0.0000781
Further Details:      
 
Domain Number 4 Region: 371-441
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000135
Family Complement control module/SCR domain 0.000063
Further Details:      
 
Domain Number 5 Region: 311-374
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000403
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 6 Region: 139-183
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000331
Family EGF-type module 0.00049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000004994   Gene: ENSOARG00000004658   Transcript: ENSOART00000005079
Sequence length 701
Comment pep:known_by_projection chromosome:Oar_v3.1:3:207353408:207366557:-1 gene:ENSOARG00000004658 transcript:ENSOART00000005079 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSCSPGMNKLPEMWCIVLFSLVAWVYAEPTMYGEVLSPNYPQAYPNEVEKSWDIEVPEGY
GIHLYFTHLDIELSENCSYDSVQIMSGGHEEGKLCGRRTSKNSNSPVVKEFHIPYNKLQV
IFRSDFSNEERFTGFAAYYVAEDVNECTAFADAPCSHFCNNFIGGYFCSCPPEYFLHEDR
KNCGVNCSGSVFTTMTGEVESPNYPSPYPESSRCDYQIQLEEGFRVVVTMRREDFDVEPA
DSEGHCPDSLLFVTGDQHFGPYCGNGFPGPLTIETQSSALNIIFQTDGSEQRKGWKFRYH
GDPIPCPKEVTANSFWEPERAKYVFRDVVKITCVDGFEVVQGSVGSPSFYSTCQSNGKWS
NSKLRCQPVDCGTPEPIRHGRVEDPESTLFGSITRYSCEVPYYSMEYEGSEVYHCSGNGS
WVNKVLGTELPKCVAVCGTPSEPFISTQRIFGGSIAKIENFPWQVFFSNPRAGGALIDEY
WVLTAAHVVEGNDIPVMYVGSSSVVTSQLSNAQMLTAERVFIHPGWEVLDSSITRKNFDN
DIALVRLTDPVKMGPKVSPICLPGTSSEYDPPENVLGLISGWGRTNARSHVIKLRGAKLP
VAPLSKCQKVKGVNPEIDISSFVFTENMICAGNDKGVDSCEGDSGGAFAVQDPKENSPKF
YVAGLVSWGPQCGTYGLYTRVKNYVDWIRKTMQEYSAPSVD
Download sequence
Identical sequences W5P3J3
XP_004006966.1.66739 XP_012030884.1.66739 ENSOARP00000004994

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]