SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000004999 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000004999
Domain Number 1 Region: 27-103
Classification Level Classification E-value
Superfamily F-box domain 0.00000000000288
Family F-box domain 0.0095
Further Details:      
 
Domain Number 2 Region: 204-305,386-461
Classification Level Classification E-value
Superfamily RNI-like 0.000000000981
Family Cyclin A/CDK2-associated p19, Skp2 0.088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000004999   Gene: ENSOARG00000004664   Transcript: ENSOART00000005084
Sequence length 1189
Comment pep:known_by_projection chromosome:Oar_v3.1:5:57311093:57369218:1 gene:ENSOARG00000004664 transcript:ENSOART00000005084 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPRKKSVKTCLTNNEIPEETVSDETKDYMNQLSHEVLCHIFRYLPLQDIMCMECLSRKL
KEAVTLYLRVVRVVDLCAGRWWEYMPSGFTDSSFLTLLKKMPDVEQLYGLHPRYLERRRV
RGHEAFSIPGVLEALQACPNLVGVETSHLELVESIWTYMPHVHILGKFRNRNGAFPIPPE
NKLKIPIGAKIQTLHLVGVNVPEIPCIPMLRHLYMKWVRLTKPQPFKDFLCISLRTFVMR
NCAGPTNSLKYVPLVTGLASARNLEHLEMVRVPFLGGLIQHVVEDSWRSGGFRNLHTIVL
GACKNALEVDLGYLIITAARRLHEVRIQPSLTKDGVFSALKMAELEFPQFETLHLGYVDE
FLLQSRMANADLVKYGLADVVENPGIITDIGMKAVNEVFSCIKYLAIYNCPHLHNPYNWI
SDHSRWTRLVDINLVRCHALKLDSFGQFIELLPSLEFISLDQMFREPPKGCARVGLSAGT
GIGVSSALVSNQNSNNDNDNNAQNNANIHDNNHHHPDDSDEENDFRQDLQPGEQQFAADA
LNEMEDMVQEDAEVMAESGHETPAHSQAVIPVDVDEEQAGPSGLQRVVKPAPITVHDSES
DDEEDSLELQEVWIPKNGSRRFSEREEKTGESVQSRELSAVSGKGKTPLRKRYNSHQMGQ
SKQFPLEESSCEKGCQVTSEQIKADMKAARDIPEKKKNKDVYPSCSSTTASTVGNSSSHS
TASQSPDFVRTVNSSGSSEPSPAEVDVPRQCVCSPGGSEDSEAMEEGDAESSVCPRCCCH
RPQESHRRTSRCSDEERPSTSRACVVNGPDGTRSAFSFRTLPQGGSSGPAHDERTNGSGS
GATGEDRRGSSQPERCDVQSNEDYPRRPLTRARSRLSHVPLVSESEVAKAKPRHAMKRKR
TADKSTSTSDPVIEDDHVQVLVLKSKNLVGVTMTNCGITDLVLKDCPKMMFIHATRCRVL
KHLKVENAPIVNRFDYAQCKKLNMDQVLDQILRMPPERNRIIYLRPMQQVDTLTLEQKLF
SGPYPYHICIIHEFSNPPNVRNKVRIRSWMDTIANINQELIKYEFFPEATRSEDDLKKYP
KYPWGREIYTLEGVVDGAPYSMISDFPWLRSLRAAEPNSFARYDFEDDEESTIYAPRRKG
QLSADICMETIGEEISEMRQMKKGVFQRVVAIFIHYCDVNGEPVEDDYI
Download sequence
Identical sequences W5P3J8
ENSOARP00000004999

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]