SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000005058 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000005058
Domain Number 1 Region: 51-110
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000786
Family I set domains 0.051
Further Details:      
 
Weak hits

Sequence:  ENSOARP00000005058
Domain Number - Region: 156-192
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00445
Family TSP-1 type 1 repeat 0.0066
Further Details:      
 
Domain Number - Region: 237-302
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0368
Family V set domains (antibody variable domain-like) 0.092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000005058   Gene: ENSOARG00000004728   Transcript: ENSOART00000005143
Sequence length 380
Comment pep:known_by_projection chromosome:Oar_v3.1:14:45037541:45041882:-1 gene:ENSOARG00000004728 transcript:ENSOART00000005143 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KSRVGPGPLSQSQSTMLTTLWLLLCFALPVQESPFPISCPNRKQCQLALLSDNDIILHCN
APGAQWQFFTPLKTTWASNFTTNLNMVTMLNGSLLIKNPLPSHTGIYNCNDKDGKKVMRY
EIDFQDVITLHITHKDLDQKPLQNESLSLSSKQFVFTQWEPWQDCNQCGKPGERKRLGYC
YIQESLENVMPCWLYLGDEKVWSNRLRPEMQVETCHIPCTHIYAKYVVFDNFQLRNNVGS
AWLTCPLGSIYRPVFWEANNLSLTWKDQLSGKSISTIMDSSNGGSWLQVFQSAIYRCFVQ
RELMAQFNSKVNVDPLKFLSSENSKQQPEAEETQKENGNSVFKGLNVMMLVGMVLTVLGC
LLKQFHFSRRRERNKMFLVK
Download sequence
Identical sequences W5P3Q6
ENSOARP00000005058

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]