SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000005093 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000005093
Domain Number 1 Region: 22-108
Classification Level Classification E-value
Superfamily F-box domain 0.00000000262
Family F-box domain 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000005093   Gene: ENSOARG00000004759   Transcript: ENSOART00000005179
Sequence length 459
Comment pep:known_by_projection chromosome:Oar_v3.1:23:4204635:4234754:1 gene:ENSOARG00000004759 transcript:ENSOART00000005179 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPSGPAALSRHARQDKVCRRPSAGCSASLDSLPSEVLLKILSYLDAAALLCAGCLANDN
FIWIRLYSAAFSPKRSHWRVDPAEKMDLSVNLLSAGDKEAGYWKKEYLTKQIASVKAALA
QVLKPLHPNTGLPVKTKEALRVSGLGWVIILRGADGREYTMEHADLSVNDSSVTVAWYGK
DWPPLATLSTLDLCGVTPVFMGKSRAPSRTRPRWHSLITKYQLSQLTESSAVGGDRLMRV
FCLPPGLVVGLWKREEELAFVMANLHLHRLMERSMLGSPAVPYELPPHTPVSDDSPERGL
HGYRLHVDMHSGGVSCLCGSFRNLSASKGYLENEYMKLSVISFKNNTEHLPLIGKVGLSW
KTNSFDGCIKSCSIMDLTLLEEYGQPFWCFSSPVCVRCCPGPSDGPNFLGEAYYVDYSDS
EGRLRMELVWIEETEEYFIVSLALYLRLAKVNQWFGTEY
Download sequence
Identical sequences W5P3U1
ENSOARP00000005093

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]