SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000005133 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000005133
Domain Number 1 Region: 50-154
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.2e-32
Family Spermadhesin, CUB domain 0.00019
Further Details:      
 
Domain Number 2 Region: 170-293
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.44e-18
Family Spermadhesin, CUB domain 0.0046
Further Details:      
 
Domain Number 3 Region: 291-327
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000288
Family LDL receptor-like module 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000005133   Gene: ENSOARG00000004791   Transcript: ENSOART00000005219
Sequence length 533
Comment pep:known_by_projection chromosome:Oar_v3.1:23:5042631:5145500:1 gene:ENSOARG00000004791 transcript:ENSOART00000005219 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIYGRSLFHIVASLIILHLSGAAKKGTEKQTTSETQKSVQCGTWTKHAEGGIFTSPNYPS
KYPPDRECIYIIEAAPRQCIELYFDEKYSIEPSWECKFDHIEVRDGPFGFSPIIGRFCGQ
QNPPVIKSSGRFLWIKFFADGELESMGFSARYNFTPDPDFKDLGVLKPLPVCEFEMGGPE
GIVESIQIMKEGKASASEAVDCKWYIRAPPRSKIYLRFLDYEMQNSNECKRNFVAVYDGS
SSVEDLKAKFCSTVANDVMLRTGLGVIRMWADEGSRNSRFQMLFTSFQEPPCEGNTFFCH
SNMCINNTLVCNGLQNCVYPWDENHCKEKRKAGLLDQLTNTSGTVIGVTSCIVIILIIIS
VIVQIKQPRKKYVQRKSDFDQTVFQEVFEPPHYELCTLRGTGTTADFADVADDFENYHKL
RRSSSKCIHDHHCGSQLSSAKGSRSNLSTRDASVLTEMPPQPVKPLIPPMNRRNILVMKH
NYSQEAADACDIDEIEEVPTTSHRLSRHEKAVQRFCLIGSLSKHESEYNTTRV
Download sequence
Identical sequences W5P3Y1
ENSOARP00000005133 XP_004020448.1.66739 XP_012022402.1.54773 XP_014946025.1.54773 XP_014959059.1.66739

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]