SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000005149 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000005149
Domain Number 1 Region: 522-554,654-729
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000000000121
Family Anti-sigma factor antagonist SpoIIaa 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000005149   Gene: ENSOARG00000004798   Transcript: ENSOART00000005235
Sequence length 779
Comment pep:known_by_projection chromosome:Oar_v3.1:12:2935972:2955212:-1 gene:ENSOARG00000004798 transcript:ENSOART00000005235 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQPRPRYVVDRAAYSLTLFDDEFEKKDRTYPLGEKLCNTFRCSSAKIKTTVFGLLPILS
WLPKYKIKDYIVPDILGGLSGGCIQVPQGMAFALLANLPAVNGLYSSFFPLLTYFFLGGI
HQMVPGTFAVISILVGNICLQLAPESKFRVFNNATNESYVDTGAMEADRLHVSATLACLT
AVIQMGLGFMQFGFVAIYLSESFIRGFMTAAGLQILISVLKYIFGLTVPSYAGPGSIVFT
FIDICKNLAHTNIASLIFALISGVVLVLVKELNARYMHKIRFPIPTEMIVVVVATAISGS
YKMPKKYHMQIVGEIQPGFPAPVSPVVSQWKDMLGTAFSLAIVGYVINLAMGRTLANKHG
YDVDANQEMIALGCSNFFGSFFKIHVICCALSVTLAVDGAGGKSQVSSLCVSLVVMITML
VLGSYLYALPKSVLGALIAVNLKNSLKQLADPYYLWKKSKLDCCVWVVSFLSAFFLSLPY
GVAGGGTFSPPGVGFQTPFRNGYALAQVMDTDIYVNPKTYNRVQEIQGVKIITYCSPLYF
ANSEIFRQKVIAKTGVDPQKVLLAKQKHLKKQEKGRTMPTQQRKSLFMKTKTVSLQELQQ
DFENGSPTDPNNNQTPANGASVSYITFSPDDSTAARCEPPASAKPNDMLASVPPFVTFHT
LILDMSGVSFVDLMGIKALAKLSSTYEKIGVKVFLANIHAQVYDDISHGGLFEGGCLERS
HIFPSIHDAVLFAQAQAREVAPGHDFQGAPVDPELSLYEPEEDSPSYWDLEQEMFGSMP
Download sequence
Identical sequences W5P3Z7
ENSOARP00000005149

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]