SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000005192 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000005192
Domain Number 1 Region: 699-1051
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 1.57e-120
Family Hect, E3 ligase catalytic domain 0.000000113
Further Details:      
 
Domain Number 2 Region: 2-347
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 1.92e-103
Family Regulator of chromosome condensation RCC1 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000005192   Gene: ENSOARG00000004840   Transcript: ENSOART00000005279
Sequence length 1057
Comment pep:known_by_projection chromosome:Oar_v3.1:25:24259747:24385191:-1 gene:ENSOARG00000004840 transcript:ENSOART00000005279 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLCWGNASFGQLGLGGIDEEIVLEPRKSDFFVNKKVRDVGCGLRHTVFVLDDGTVYTCGC
NDLGQLGHEKSRKKPEQVVALDAQNIVAVSCGEAHTLALNDKGQVYAWGLDSDGQLGLLG
SEECIRVPRNIKSLSDIQIVQVACGYYHSLALSKASEVFCWGQNKYGQLGLGIDCKKQAS
PQLIKSLLGIPFMQIAAGGAHSFVLTLSGAIFGWGRNKFGQLGLNDENDRYVPNLLKSLR
TQKIVYICCGEDHTAALTKEGGVFTFGAGGYGQLGHNSTSHEINPRKVFELMGSIVTQIA
CGRQHTSAFVPSSGRIYSFGLGGNGQLGTGSTSNRKSPFTVKGNWFPYNGQCPPDFDSEE
YFCVKRIFSGGDQSFSHYSNPQNCGPPDDFRYPDPSKQIWTVNEALIQKWLSYPSGRFPV
EIANEIDGTFSSSGCLNGSFLAVSNDDHYRTGTRFSGVDMNAARLLFHKLIQPDHPQISQ
QVAASLEKNLIPKLTSSLPDVEALRFYLTLPECPLMSDSNNFTTIAIPFGTALVNLEKAP
LKVLENWWSVLEPPLFLKIVELFKEVVVHLLKLYKIGIPPSERRIFNSFLHTALKVLEIL
HRVNEKSGQIIQYDKFYIHEVQELIDIRNDYIIWVQQQAYGMDVNHGLTELADIPVTICT
YPFVFDAQAKTTLLQTDAVLQMQMAIDQAHRQNVSSLFLPVIESVNPCLILVVRRENIVG
DAMEVLRKTKNIDYKKPLKVIFVGEDAVDAGGVRKEFFLLIMRELLDPKYGMFRYYEDSR
LIWFSDKTFEDSDLFHLIGVICGLAIYNFTIVDLHFPLALYKKLLKKKPSLEDLKELVPD
VGRSMQQLLDYPEDDVEETFCLNFTITVENFGATEVKELVLNGADTAVNKQNRQEFVDAY
VDYIFNKSVASLFDAFHAGFHKVCGGKVLQLFQPNELQAMVIGNTNYDWKELEKNTEYKG
EYWAEHPTIKMFWEVFHELPLEKKKQFLLFLTGSDRIPILGMKSLILVIQSTGGGEEYLP
VSHTCFNLLDLPKYTDKETLRSKLIQAIDHNEGFSLI
Download sequence
Identical sequences W5P440
XP_011981028.1.54773 XP_014959864.1.66739 XP_014959865.1.66739 XP_014959866.1.66739 XP_014961378.1.54773 XP_014961379.1.54773 XP_017897782.1.57651 ENSOARP00000005192

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]