SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000005203 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000005203
Domain Number 1 Region: 469-770
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 7.33e-103
Family PDEase 0.000000583
Further Details:      
 
Domain Number 2 Region: 254-445
Classification Level Classification E-value
Superfamily GAF domain-like 4.58e-48
Family GAF domain 0.00003
Further Details:      
 
Domain Number 3 Region: 103-246
Classification Level Classification E-value
Superfamily GAF domain-like 8.72e-20
Family GAF domain 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000005203   Gene: ENSOARG00000004847   Transcript: ENSOART00000005290
Sequence length 791
Comment pep:known_by_projection chromosome:Oar_v3.1:8:87118930:87472911:-1 gene:ENSOARG00000004847 transcript:ENSOART00000005290 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSHEPAEGGLDARDASDLTDEKVKAYLSLHPQVLDEFVSESVSAETVEKWLKRKNKKSED
ESAPKEVSRYQDTNMQGVVYELNSYIEQRLDTGGDNQLLLYELSSIIKIALAATKADGFA
LYFLGECNNSLCVFIPPGIKEGKPKLIPAGPIAQGTTTSAYVAKSRKTLLVEDILGDERF
PRGTGLESGTRIQSVLCLPIVTAIGDLIGILELYRHWGKEAFCLSHQEVATANLAWASVA
IHQVQVCRGLAKQTELNDFLLDVSKTYFDNIVAIDSLLEHIMIYAKNLVNADRCALFQVD
HKNQELYSDLFDIGEEKEGKPVFKKTKEIRFSIEKGIAGQVARTGEVLNIPDAYADPRFN
REVDLYTGYTTRNILCMPIVSRGSVIGVVQMVNKLSGSAFSKTDENNFKMFAVFCALALH
CANMYHRIRHSECIYRVTMEKLSYHSICTAEEWQGLMHFSLPGRLCKEIELFHFDVGPFE
NMWPGIFVYMIHRSCGTACFELEKLCRFIMSVKKNYRRVPYHNWKHAVTVAHCMYAILQN
NHGLFTDLERKGLLIACLCHDLDHRGFSNSYLQKFDHPLAALYSTSTMEQHHFSQTVSIL
QLEGHNIFSTLSSSEYEQVLEIIRKAIIATDLALYFGNRKQLEEMYQTGSLNLNNQSHRD
RVIGLMMTACDLCSVTKLWPVTRLTANDIYAEFWAEGDEMKKLGIQPIPMMDRDKKDEVP
QGQLGFYNAVAIPCYTTLTQIFPATEPLLKACRNNLSQWEKVIRGEESALGILDLPEAEG
SPERPPVKTDD
Download sequence
Identical sequences W5P451
ENSOARP00000005203

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]