SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000005210 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000005210
Domain Number 1 Region: 156-207
Classification Level Classification E-value
Superfamily SNARE fusion complex 0.000000000277
Family SNARE fusion complex 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000005210   Gene: ENSOARG00000004861   Transcript: ENSOART00000005297
Sequence length 210
Comment pep:known_by_projection chromosome:Oar_v3.1:18:33919740:34146066:-1 gene:ENSOARG00000004861 transcript:ENSOART00000005297 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVKSAISKEIFAPLDERMLGAVQVKRRTKKKIPFLATGGQGEYLTYICLSVTNKKPTQA
SITKVKQFEGSTSFVRRSQWMLEQLRQVNGIDPNRDSAEFDLLFENAFDQWVASTASEKC
TFFQILHHTCQRYLTDRKPEFINCQSKIMGGNSILHSAADSVTSAVQKASQALNERGERL
GRAEEKTEDLKNSAQQFAETAHKLAMKHKC
Download sequence
Identical sequences W5P458
ENSOARP00000005210 XP_004017921.1.66739 XP_011954117.1.66739 XP_011954118.1.66739 XP_011954120.1.66739 XP_011954121.1.66739 XP_012016732.1.54773 XP_012016733.1.54773 XP_012016734.1.54773 XP_012016735.1.54773 XP_012016737.1.54773 XP_012016738.1.54773 XP_012016739.1.54773 XP_012016740.1.54773 XP_012016741.1.54773 XP_014945259.1.54773 XP_014957479.1.66739 XP_014957480.1.66739 XP_014957481.1.66739

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]