SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000005468 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000005468
Domain Number 1 Region: 5-449,561-616
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 5.61e-73
Family GDI-like N domain 0.0000000000466
Further Details:      
 
Domain Number 2 Region: 450-560
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 1.49e-37
Family GDI-like 0.00000336
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000005468   Gene: ENSOARG00000005101   Transcript: ENSOART00000005555
Sequence length 655
Comment pep:known_by_projection chromosome:Oar_v3.1:12:33314306:33316273:1 gene:ENSOARG00000005101 transcript:ENSOART00000005555 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MANSLPTEFDVIVMGTGLPESILAAACSRSGQRVLHLDSRSYYGGNWASFSFPGLLSWLK
EHRQNSDTVEESPAAWQDMIHETEEAIPLCKKDETIQHAEVFCYASQGMDGNIEELDALQ
KNPCVASSTLIKPLDSTSLSEETHSSHITSYEVPTQDNNVDNNPKNNEEITDTAETSVKE
EYCGYDTYKHTLSDGTKDEIKPVLENNSVPPKRKRIAYSQIVKEGRRFNIDLSSKLLYSQ
GLLIDLLIKSNVSRYAEFKNVTRILAFREGKVEQVPCSRADVFNSKELTMVEKRMLMKFL
TFCLDYEQHPEEYQAFTQCSFSEYLKTKKLTPSLQHFILHSIAMMSESSCTTVDGLKATK
NFLQCLGRFGNTPFLFPLYGQGEIPQCFCRMCAVFGGIYCLRHKVQCLVVDRESGRCKAI
IDHLGQRINAKYFIVEDSYLSEETCSSVQYKQISRAVLITDQSVLKTDSDQQISILIVPP
VEPGAHAVRIIELCSSTMTCMKDTYLVHLTCSSSKTAREDLESVVKKLFTPYSETEVDKE
ELPKPGLLWALYFNMRDSSGVSRSSYNGLPPNVYVCTGPDCGLGSEHAVKQAETLFHEIF
PSEEFCPPPPNPEDIFFDGDEKPSEPLGTSNIVMAKLESSEGSKNLESSGKHLQN
Download sequence
Identical sequences W5P4W5
XP_004013714.1.66739 XP_012042616.1.66739 ENSOARP00000005468

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]