SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000005504 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000005504
Domain Number 1 Region: 523-633
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.13e-19
Family Spermadhesin, CUB domain 0.0013
Further Details:      
 
Domain Number 2 Region: 339-455
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000000000119
Family Spermadhesin, CUB domain 0.0047
Further Details:      
 
Domain Number 3 Region: 164-287
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000000000017
Family Spermadhesin, CUB domain 0.0073
Further Details:      
 
Domain Number 4 Region: 285-347
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000292
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 5 Region: 702-763
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000167
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 6 Region: 770-836
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000324
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 7 Region: 639-691
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000297
Family Complement control module/SCR domain 0.0039
Further Details:      
 
Domain Number 8 Region: 460-525
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000256
Family Complement control module/SCR domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000005504   Gene: ENSOARG00000005130   Transcript: ENSOART00000005591
Sequence length 909
Comment pep:known_by_projection chromosome:Oar_v3.1:24:26373702:26393367:1 gene:ENSOARG00000005130 transcript:ENSOART00000005591 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTPRAQHPPPLQLLFLFLLSCPWMGGCLPLKEEEALPEPGSETPAVASEALAELLHGAL
LRKGPEMGYLPGSDPDPTLATPPVGQTIAAPFLPRATEPGTGPLTTAVTPKGGRGAGPTA
PELLTPPPGTTAPPPPAPPLGPEGGEEETTTTIITTTTVTTTVTSRVLCNNNISEGEGHV
ESPDLGSAASRTLGLLDCTYSIHVYPGYGIEIQVQMLNLSREEELLVLAGGGSPGLAPRL
LANSSMLGEGQVLRSPTNRLLLHFQSPRVPRGAGFRIHYQAYLLSCGFPPQPAHGDVSVT
DLHPGGTATFHCDSGYQLQGEETLVCLNGTRPAWSSEPPSCVASCGGTIHNATLGRIVSP
EPGGAAGPNLTCRWVIEAAEGRRLHLHFERVSLDEDNDRLMVRSGGSPLSPVIYDSDMDD
VPERGLISDAQSLYVELLSETPANPLLLSLRFEAFEEDRCFAPFLAHGNVTTTDPEYRPG
ALATFSCLPGYALEPPGPPNVIECVDPTEPHWNDTEPACKAMCGGELSEPAGVVLSPDWP
QSYSPGQDCVWGLHVQEEKRILLQVEILNVREGDMLTLFDGDGPSARVLAQLRGPQPRRR
LLSSGSDLTLQFQAPPGPPNPGLGQGFVLHFKEVPRNDTCPELPPPEWGWRTASHGDLIR
GTVLTYQCEPGYELLGSDILTCQWDLSWPLPLMAPPLPTQFMTCADPGEITNGHRTTSDA
GFPVGSHVQYRCLPGYSLEGAAVLTCYSRDTGTPKWSDRVPKCALKYEPCLNPGVPENGY
QTLYKHHYQAGESLRFFCYEGFELIGEVTITCVPGHPSQWTSQPPLCKVTQTTDPSRQLE
GGNLALAILLPLGLVIVLGSGVYIYYTKLQGKSLFGFSGSHSYSPITVESDFSNPLYEAG
DTREYEVSI
Download sequence
Identical sequences W5P501
ENSOARP00000005504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]