SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000005543 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000005543
Domain Number 1 Region: 111-244,288-472
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.22e-32
Family WD40-repeat 0.0043
Further Details:      
 
Domain Number 2 Region: 27-111
Classification Level Classification E-value
Superfamily F-box domain 7.85e-21
Family F-box domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000005543   Gene: ENSOARG00000005170   Transcript: ENSOART00000005630
Sequence length 507
Comment pep:known_by_projection chromosome:Oar_v3.1:17:57621899:57721505:-1 gene:ENSOARG00000005170 transcript:ENSOART00000005630 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFQNFNISFLFFPPQNEMDDVPFFDIQLPYELAINIFQYLNRRELGRCAQVSKTWKVIAE
DEVLWYRLCQQEGHLPESSISDYSCWKLVFQECRAKEHMLRTNWKNRKGAVSELEHIPDA
VLCDVHSHDGVVIAGYTSGDVRVWDTRTWDYTAPFLESEFEEDEPGMQPYVSFVRINSSL
AVAAYEDGFLNIWNLRTGKYPIHRFEHDARIQALALSQEDATIATASAFDVVMLCPNEEG
NLQIAAEFEVQKLVDYLEIVPDTERYPVAVATAGDLVYLLKAEDSARTLHYVYGQPVTCL
DVSANQAAFGVKSLGWVYEGNKILVYSLEAERCVSKLGNALGDFSCVNLRDSPPNLMVSG
NMDRRVRIHDLRTDSIALSISAHQLGVSAVQMDDWKIVSGGEEGLVSVWDYRMSQKLWEV
HSRHPVRHISFNSHSLITAHVPYERVVRNADLDNFATHRRHRGLIQAYAFAVDQLAFQST
VPICRSACDAMPGYNYDLALAFPPDRI
Download sequence
Identical sequences W5P540
XP_014957135.1.66739 ENSOARP00000005543

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]