SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000005568 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000005568
Domain Number 1 Region: 4825-5040
Classification Level Classification E-value
Superfamily GFP-like 1.46e-63
Family Domain G2 of nidogen-1 0.00064
Further Details:      
 
Domain Number 2 Region: 2427-2523
Classification Level Classification E-value
Superfamily Immunoglobulin 2.63e-25
Family I set domains 0.013
Further Details:      
 
Domain Number 3 Region: 2533-2620
Classification Level Classification E-value
Superfamily Immunoglobulin 2.52e-24
Family I set domains 0.0092
Further Details:      
 
Domain Number 4 Region: 3580-3672
Classification Level Classification E-value
Superfamily Immunoglobulin 3.32e-24
Family I set domains 0.008
Further Details:      
 
Domain Number 5 Region: 2910-3009
Classification Level Classification E-value
Superfamily Immunoglobulin 4.02e-24
Family I set domains 0.0054
Further Details:      
 
Domain Number 6 Region: 1113-1210
Classification Level Classification E-value
Superfamily Immunoglobulin 6.59e-24
Family I set domains 0.012
Further Details:      
 
Domain Number 7 Region: 4030-4124
Classification Level Classification E-value
Superfamily Immunoglobulin 2.7e-23
Family I set domains 0.045
Further Details:      
 
Domain Number 8 Region: 3661-3759
Classification Level Classification E-value
Superfamily Immunoglobulin 4.19e-23
Family I set domains 0.015
Further Details:      
 
Domain Number 9 Region: 2344-2432
Classification Level Classification E-value
Superfamily Immunoglobulin 6.23e-23
Family I set domains 0.014
Further Details:      
 
Domain Number 10 Region: 3194-3289
Classification Level Classification E-value
Superfamily Immunoglobulin 6.85e-23
Family I set domains 0.0041
Further Details:      
 
Domain Number 11 Region: 2830-2918
Classification Level Classification E-value
Superfamily Immunoglobulin 7.72e-23
Family I set domains 0.0083
Further Details:      
 
Domain Number 12 Region: 2631-2719
Classification Level Classification E-value
Superfamily Immunoglobulin 1.02e-22
Family I set domains 0.015
Further Details:      
 
Domain Number 13 Region: 1035-1126
Classification Level Classification E-value
Superfamily Immunoglobulin 1.67e-22
Family I set domains 0.011
Further Details:      
 
Domain Number 14 Region: 4117-4215
Classification Level Classification E-value
Superfamily Immunoglobulin 2.11e-22
Family I set domains 0.019
Further Details:      
 
Domain Number 15 Region: 4300-4399
Classification Level Classification E-value
Superfamily Immunoglobulin 2.16e-22
Family I set domains 0.0089
Further Details:      
 
Domain Number 16 Region: 741-835
Classification Level Classification E-value
Superfamily Immunoglobulin 2.51e-22
Family I set domains 0.014
Further Details:      
 
Domain Number 17 Region: 3002-3104
Classification Level Classification E-value
Superfamily Immunoglobulin 2.93e-22
Family I set domains 0.0097
Further Details:      
 
Domain Number 18 Region: 553-648
Classification Level Classification E-value
Superfamily Immunoglobulin 3.24e-22
Family I set domains 0.013
Further Details:      
 
Domain Number 19 Region: 1396-1497
Classification Level Classification E-value
Superfamily Immunoglobulin 3.65e-22
Family I set domains 0.018
Further Details:      
 
Domain Number 20 Region: 3848-3945
Classification Level Classification E-value
Superfamily Immunoglobulin 6.29e-22
Family I set domains 0.018
Further Details:      
 
Domain Number 21 Region: 838-932
Classification Level Classification E-value
Superfamily Immunoglobulin 8.72e-22
Family I set domains 0.01
Further Details:      
 
Domain Number 22 Region: 3940-4034
Classification Level Classification E-value
Superfamily Immunoglobulin 1.37e-21
Family I set domains 0.024
Further Details:      
 
Domain Number 23 Region: 3097-3197
Classification Level Classification E-value
Superfamily Immunoglobulin 1.68e-21
Family I set domains 0.0086
Further Details:      
 
Domain Number 24 Region: 1880-1966
Classification Level Classification E-value
Superfamily Immunoglobulin 1.96e-21
Family I set domains 0.03
Further Details:      
 
Domain Number 25 Region: 1315-1404
Classification Level Classification E-value
Superfamily Immunoglobulin 2.24e-21
Family I set domains 0.019
Further Details:      
 
Domain Number 26 Region: 2249-2338
Classification Level Classification E-value
Superfamily Immunoglobulin 2.91e-21
Family I set domains 0.017
Further Details:      
 
Domain Number 27 Region: 3753-3852
Classification Level Classification E-value
Superfamily Immunoglobulin 4.47e-21
Family I set domains 0.0073
Further Details:      
 
Domain Number 28 Region: 2054-2148
Classification Level Classification E-value
Superfamily Immunoglobulin 5.03e-21
Family I set domains 0.0076
Further Details:      
 
Domain Number 29 Region: 4392-4485
Classification Level Classification E-value
Superfamily Immunoglobulin 5.52e-21
Family I set domains 0.013
Further Details:      
 
Domain Number 30 Region: 2740-2822
Classification Level Classification E-value
Superfamily Immunoglobulin 6.75e-21
Family I set domains 0.016
Further Details:      
 
Domain Number 31 Region: 467-566
Classification Level Classification E-value
Superfamily Immunoglobulin 6.95e-21
Family I set domains 0.028
Further Details:      
 
Domain Number 32 Region: 1775-1871
Classification Level Classification E-value
Superfamily Immunoglobulin 1.13e-20
Family I set domains 0.011
Further Details:      
 
Domain Number 33 Region: 3478-3575
Classification Level Classification E-value
Superfamily Immunoglobulin 1.38e-20
Family I set domains 0.027
Further Details:      
 
Domain Number 34 Region: 3396-3482
Classification Level Classification E-value
Superfamily Immunoglobulin 1.67e-20
Family I set domains 0.016
Further Details:      
 
Domain Number 35 Region: 3303-3389
Classification Level Classification E-value
Superfamily Immunoglobulin 1.82e-20
Family I set domains 0.015
Further Details:      
 
Domain Number 36 Region: 1677-1773
Classification Level Classification E-value
Superfamily Immunoglobulin 1.96e-20
Family I set domains 0.01
Further Details:      
 
Domain Number 37 Region: 4206-4301
Classification Level Classification E-value
Superfamily Immunoglobulin 6.41e-20
Family I set domains 0.014
Further Details:      
 
Domain Number 38 Region: 1583-1684
Classification Level Classification E-value
Superfamily Immunoglobulin 2.2e-19
Family I set domains 0.0055
Further Details:      
 
Domain Number 39 Region: 1491-1590
Classification Level Classification E-value
Superfamily Immunoglobulin 2.24e-19
Family I set domains 0.0039
Further Details:      
 
Domain Number 40 Region: 1959-2057
Classification Level Classification E-value
Superfamily Immunoglobulin 3.51e-19
Family I set domains 0.0063
Further Details:      
 
Domain Number 41 Region: 650-748
Classification Level Classification E-value
Superfamily Immunoglobulin 9.84e-19
Family I set domains 0.02
Further Details:      
 
Domain Number 42 Region: 1217-1310
Classification Level Classification E-value
Superfamily Immunoglobulin 1.37e-18
Family I set domains 0.005
Further Details:      
 
Domain Number 43 Region: 2142-2243
Classification Level Classification E-value
Superfamily Immunoglobulin 8.2e-18
Family I set domains 0.015
Further Details:      
 
Domain Number 44 Region: 930-1023
Classification Level Classification E-value
Superfamily Immunoglobulin 3.45e-17
Family I set domains 0.0088
Further Details:      
 
Domain Number 45 Region: 5046-5191
Classification Level Classification E-value
Superfamily Growth factor receptor domain 4.24e-16
Family Growth factor receptor domain 0.02
Further Details:      
 
Domain Number 46 Region: 4592-4650
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 8.11e-16
Family TSP-1 type 1 repeat 0.00016
Further Details:      
 
Domain Number 47 Region: 1-166
Classification Level Classification E-value
Superfamily vWA-like 0.00000000000000142
Family Integrin A (or I) domain 0.03
Further Details:      
 
Domain Number 48 Region: 4535-4593
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000366
Family TSP-1 type 1 repeat 0.00036
Further Details:      
 
Domain Number 49 Region: 4480-4536
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000122
Family TSP-1 type 1 repeat 0.00026
Further Details:      
 
Domain Number 50 Region: 4650-4707
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000392
Family TSP-1 type 1 repeat 0.00023
Further Details:      
 
Domain Number 51 Region: 4764-4821
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000379
Family TSP-1 type 1 repeat 0.00023
Further Details:      
 
Domain Number 52 Region: 4707-4764
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000445
Family TSP-1 type 1 repeat 0.00031
Further Details:      
 
Domain Number 53 Region: 5155-5260
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000141
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 54 Region: 5366-5482
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000408
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 55 Region: 5268-5314
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000168
Family EGF-type module 0.01
Further Details:      
 
Domain Number 56 Region: 379-470
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000392
Family I set domains 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000005568   Gene: ENSOARG00000005151   Transcript: ENSOART00000005655
Sequence length 5590
Comment pep:known_by_projection chromosome:Oar_v3.1:12:64798855:65337057:1 gene:ENSOARG00000005151 transcript:ENSOART00000005655 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYDDLVQVIEGASKILETSLKRPKRPLFNFALVPFHDPEIGPVTVTTDPKKFQYELRELY
VQGGGDCPEMSIGAIKIALEISLPGSFIYVFTDARSKDYRLTHEVLQLIQQKQSQVVFVL
TGDCDDRSHIGYRVYEEIASTSSGQVFHLDKKQVNEVLKWVEEAVQASKVHLLSTDHLEQ
AVNTWKIPFDPSLKEVTVSLSGPSPMIEIRNPLGKLIKKGFGLNELLNIHNSAKVVNVKE
PEAGIWTVKTSSTGRHSVRITGLSTIDFRAGFSRKPTLDFKKTVSRPVQGIPTYVLLNTS
GISIPARVDRLELLSISGSSLKTIPVKYYPDRKPYGIWNISDFIPPNEAFFLKVTGYDKD
DFPFQRVSSVSFSSIVPDAPKVTMPEKTPGYYLQPGQIPCAIDSLLPFTLSFVRNGVTLG
VDQYLKESARVTWDIEEVTLSDEGPYECIAVSSAGTGRAQTFFDVSEPPPVIQVPNNVTV
TPGETAVLTCLVVSAVGYNLTWQRNGRDVRLTAPAGMRILANLSLELRSVKFSDAGEYRC
VVSNEGGSSTEAVFLTVQEPPKVTVMPKNQSFTGGSEVSIMCSVTGYPKPKISWTMNDMF
IVGSHRYRMTSEGNLFIKNAVPKDAGIYGCLASNSAGMDKQISTLRYIEAPKLIVVQSEL
LVALGDTTVMECKTSGVPPPQVKWFKGDLELKPSTFLIIDPLLGLLKIQETQDLDAGDYT
CVAVNDAGRATGRITLDVGSPPVFIQEPTDVSVEIGSNVTLPCYVQGYPEPKIKWRRLDN
MPIFSRPFSVSSISQLRTGDLFISNLWASDKGTYICEAENQFGKIQSQTTVTVTGLVAPL
IGISPPVTSVIEGQQLTLPCALLAGNPIPERRWIKNSAMLVQNPYITVRSDGSLHIERVR
LQDGGEYTCVASNVAGTTNKTTTVDVHVLPTIQHGQQILSTIEGIPVTLPCKASGIPKPS
IAWSKKGELISTSSAKFSAGADGSLYVVSPGGEESGEYVCTATNAAGYAKRKVQLTVYVR
PRVFGDQRGPSQDKPVEISVLAGEEVTLPCEVKSLPPPVITWAKETQLISPFSPRHTFLP
SGSMKITETRVSDSGMYLCVATNIAGNVTQSVKLNVHVPPKIQRGPKVMKVQVGQRVDIP
CSAQGTPLPVITWFKGGSAVLVDGLQHISHPDGTLSIKQAMLSDAGIYICVATNIAGSDE
TEITLHVQEPPILEDLEPPYNTAFQERVANQRIAFPCPAKGTPKPTIKWLRNGRELTGQE
LGISILEDGTLLVIASVTPYDNGEYICVAVNEAGTTERRYNLKVHVPPVIKDKEQVTNVS
VLVNQPTSLFCEVEGTPSPIVMWYKDDVQVTESSSIQVINNGKILKLFRASPEDAGRYSC
KAVNVAGASQKHFNIDVLVPPTIIGAGSPGEVSVVLNQDTTLECQVKGTPFPVIHWFKDG
KPLFLEDPNIEILDRGQILHLKNARRSDKGRYQCTVSNAAGKQAKDIKLTIYIPPSIKGG
NVTTEVSALINSVIKLECETRGLPMPAITWYKDGQPVISSSQALYVEKGQFLHIPRAQVT
DSAAYKCLVTNVAGSAEKSFHVDVYVPPMIEGDLAAPLNKQVIVAHSLTLECKAAGNPPP
VLTWLKDGVPVKVSDNLRIEAGGKKLEITSALEVDRGQYICVATSVAGEKEIKYEVDVLV
PPAIEGGDETSYFIVMVNNLLELDCQVTGSPPPTIMWLKDGQLIDERDGFKILLNGRKLV
IAQAQVSDTGLYRCVATNTAGDHKKEFEVTVHDLVPPTIKSSGLSERAVLKYKPIALQCI
ANGIPNPSITWLKDGQPVNTAQGNLKIQSSGRLLQIAKALMEDAGRYTCVATNAAGETQQ
LIQLHVHEPPSLEDAGKMLNETVVVNSPVQLECKAAGTPTPAITWYKDNRPLSDSSSVTF
LNRGQIINIESAQITDAGIYKCVAINSAGATELLYSLQVHVPPSIFGSNDMVAVVVNNLV
RLECEARGIPAPSLTWLKDGSPVASFVNGIQVLSGGRILALTSAQISDTGRYTCVAINAA
GEKQRDIDLRVYVAPNIMGEEQNVSVLISQAVELLCRSDAIPPPTLTWLKDGRPLLKKPG
LSVTENGSVLKIEDAQVQDSGRYTCEATNVAGKTEKNYNVNIWVPPNISGSDEVAQLTVI
EGHLISLLCESSGIPPPNLLWKKKGSAVLADSAGRVRILSGGRQLQISIAEKSDAGLYSC
MASNVAGTAKKDYSLQVYTRPTISNSGSHPTEVIVTRGKSVSLECEVEGIPQPAVTWMKD
GRPLTKGRGMEIMGEGRGVQLKNVHVSDTGRYVCVAMNIAGMTDRKYDLSVHTPPSIIGN
HRTPENISVVEKSSVSLNCEASGIPLPSITWLKDGWPVNLSSSLRILSGGRILRLIRTRT
EDAGQYTCVVRNAAGEERKIFRLSILVPPRIMGENAFEDVKVKEKQSVTLTCEVTGNPVP
EITWHKDGQLLKEDDAHHLMSGGRFLQIVNAQVSHTGRYTCLASNTAGDKSKSFSLNVLV
SPIIAGVDGDGNPEDVTVILNSPTSLVCEAYSYPPATITWFKNGTPLESNRNIRILPGGR
TLQILNAQEDDAGRYACVATNEAGEMIKHYEVKVYIPPIINKGDLLGPGLSPREVKIKVN
NTLTLECEAYAIPSASLSWYKDGQPLKSDDHVTIAASGHTLQIKETQISDTGRYTCVASN
VAGEDELDFDVNIQVPPSFQKLWEIGNMVDTGRRGEAKDVIINNPISLYCETNAAPAPTL
TWYKDGHPLTSSERVLILPGGRVLQIPRAKVEDAGRYVCVAVNEAGEDSLQYDVRVLLPP
VIKGANGDLPEEVTVLVNKSVLMECLFSGSPTPRSSWQKDGQPLLEDERHKFLSNGRILQ
VLNSQITDIGRYVCIAENTAGSAKKYFNLNVHVPPSIIGPNPENLTVVVNNFISLTCEVS
GFPPPDLSWLKNEQPIKLNTNALIVPGGRTLQIIRAKVSDGGEYTCIAINQAGESKKKVS
LTVYVPPSIKDHGSESLSVVNVREGTSVSLECESNAVPPPVITWYKNGRMLTDSAPLAIL
ADGQMLHIAKAEVSDTGQYVCRAINVAGRDDKNFHLNVYVPPSIEGPENEVTVETVSNPV
TLTCDATGLPPPSIAWLKNHKPIENSGSLEVHILSGGSKLQIARSQHSDSGNYTCIASNM
EGKAQKNYILSIQVPPNVADAEIPSEVSVLLGENVELVCNANGIPTPLIQWLKDGRPIVN
SETERIRVTADGSTLNIYGALPSDKGKYTCVATNPAGEEDRIFNLNVYDIVPPAIRGNKE
EAEKLMALVDTSINIECRATGMPPPQINWLKNGLPLPLSSHIRLLSGGQVIRIVRAQASD
VAVYTCVASNRAGVDNKHYSLQVLVPPSLHNGMGTEEITIVKGSSTSMTCFTDGTPAPRM
SWLRDGHPLGLDAHLSISSQGMVLQLIKAETEDSGRYTCIASNEAGEVSKHFILKVLQPP
HINGSEEPIEMSVIVNNPLELTCMASGIPAPKITWMKDGRPLPQMDQMQTLGGGEVLRIS
STQVEDTGRYTCLASSPAGDDDKEYLVRVHVPPNIAGTGEPQDFTVLRNRQVTLECKSDA
VPPPVITWLKNGERLQATPRIRILSGGRYLQINNADLGDTANYTCVASNIVGKTTREFIL
TVNVPPSIKSGPQSLVIHLNKSTLLECFAEGVPAPKITWRKDGAVLSGSHARYSILENGF
LHIQSAQVTDSGRYLCMATNAAGTDRRRIDLQVHVPPSIAPGPTNITVTVNVQTTLACEA
TGIPKPSINWRKNGHLLNVDQNQNSYRLLSSGSLVIISPSVDDTATYECTVTSDAGEDER
TVDLTVQVPPSIADEPTDFLVTKHTPAVITCTASGVPFPSIHWMKNGIRLLPRGEGYRIL
SSGAIEILATQLSHAGRYTCVARNSAGSAHRHVSLHVQEAPVIQPQPSELDVILNNPILL
PCEATGTPSPFITWQKEGINVISSGRSHAVLPHGDLQISRAVREDAGTYMCVAQNPAGTA
LGKIKLNVQVPPVITPHPKEYVTVVDKPIMLPCEADGLPPPDIMWHKDGHVIMESVRQRI
LSSGALQIAFAQPGDAGQYTCMAANVAGSSSTSTKLTVHVPPRIQSTEVHYTVNENSQAV
LPCVADGIPTPAINWKKDNVLLANLLGKYTVEPYGELLLENVVPEDSGTYTCVANNAAGE
DTHTISLTVHVLPTFTELPGDVSLNKGEQLRLNCKATGIPLPKLTWTFNNNIIPAHFDSV
SGHSELVIERISKEDSGTYVCTAENSVGFVKAIGFVYVKEPPVFKGDYPSNWIEPLGGNA
ILNCEVKGDPAPTIQWSRRGTDIEISHRIRQLGNGSLAIYGTVNEDAGDYTCVATNEAGV
VERSMSLTLQSPPIITLEPVETIINAGSKVILNCQATGEPRPTITWSRQGRSILWDERIN
VLSNNSLHIAAAQKEDTSEYECVARNLMGSVLVRVPVIVQVPGGFSQWSAWRPCSVTCGK
GIQKRSRLCNNPSPANGGKPCQGSDSEMQNCQHKPCPVDGNWSEWSLWEECTRSCGRGNR
TRTRTCNNPSAQHGGRPCDGIAVETIMCNIRPCPVHGAWSTWQPWGTCSVSCGKGTQTRT
RLCNNPPPSFAGSYCDGAETQMQVCNERHCPIDGKWATWTSWSACSVSCGGGARQRTRDC
SDPAPQYGGNKCEGSDVQSDFCNSDSCPTHGNWSPWSGWGICSRTCNGGQMRRYRTCDNP
HPSNGGRACGGPDSQIQRCNTDMCPVDGSWGNWHSWSWCSTSCGGGEKTRKRLCNNPIPS
KSGRPCPGDATQVSRCNIQVCPAIGGPQRARGSVIGSINDVEFGIAFLNATVTDSPNSDT
RIIHAKITNVPRSLGPAMRKIVSILNPIYWTTAKEIGEAVNGFTLTNAVFKRETQVEFAT
GEILRMTHVARGLDSDGALLVDIIVSGHVLQLQSPAEVTVKDYTEDYVQTGAGQLYAYST
RLFTIDGISVPYTWNHTVSYDEAQGRMPFLVETLHASSVESDYNQLEETLGFKIHAAISK
GERSNQCPSGFALDSVGPFCADEDECATGNPCSHFCHNAMGTYYCSCPKGLTIAADGRTC
QDIDECALGGYTCHAGQDCDNTIGSYRCVVRCGIGFRRTSDGLSCQDINECQESSPCHHR
CFNAIGSFHCGCEPGYQLKGRKCVDINECRQNVCRPDQHCKNTRGGYKCIDLCPNGMTKA
ENGTCIDVDECKDGTHQCRYNQICENTRGSYRCVCPRGYRSQGLGRPCLDINECEQVSKP
CAYQCFNTPGSFKCICPPGQHLLGDGKSCAGLERLPNYGTQYNSYNLARFSPMRNNYQPQ
QHYRQYSHLYSSYSEYRNSRTSLSRTRRTIRKTCPEGFEASLDTCVDINECENTDTCQHE
CKNTFGSYRCICPPGYQLMINGKTCQDIDECLEQNVRCGPNRMCFNMRGSYRCIETPCPP
DYQRDPVSGFCLKNCPPNDLECALSPYALEYKLVSLPFGIAANQDLIRLVAYTQDGVMHP
RTTFLMIDEEQTIPFALRDENLKGVVYTIRPLQEPETYRMRVRALSYSANGTVEYQTTFI
VYIAVSAYPY
Download sequence
Identical sequences W5P565
ENSOARP00000005568

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]