SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000005575 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSOARP00000005575
Domain Number - Region: 40-108
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 0.00222
Family Transglutaminase, two C-terminal domains 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000005575   Gene: ENSOARG00000005196   Transcript: ENSOART00000005662
Sequence length 186
Comment pep:known_by_projection chromosome:Oar_v3.1:1:104609520:104616269:-1 gene:ENSOARG00000005196 transcript:ENSOART00000005662 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCTMRLLAFAVLALFAVTQAEEGARLLASKSLLNRYAVEGRDLTLQYNIYNVGSSAALDV
ELSDDSFPPEDFGIVSGMLNVKWDRIAPASNVSHTVVLRPLKAGYFNFTSATVTYLAQED
GPVVIGFTSAPGQGGILAQREFDRRFSPHFLDWAAFGVMTLPSIGVPLLLWYSSKRKYDT
PKTKKN
Download sequence
Identical sequences W5P572
ENSOARP00000005575 XP_004002649.1.66739 XP_005677420.1.57651 XP_005898773.1.15283 XP_010836555.1.44457 XP_011987816.1.54773

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]