SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000005577 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSOARP00000005577
Domain Number - Region: 46-114
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 0.00241
Family Transglutaminase, two C-terminal domains 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000005577   Gene: ENSOARG00000005196   Transcript: ENSOART00000005664
Sequence length 192
Comment pep:known_by_projection chromosome:Oar_v3.1:1:104609520:104615658:-1 gene:ENSOARG00000005196 transcript:ENSOART00000005664 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLALLFSPKMRLLAFAVLALFAVTQAEEGARLLASKSLLNRYAVEGRDLTLQYNIYNVGS
SAALDVELSDDSFPPEDFGIVSGMLNVKWDRIAPASNVSHTVVLRPLKAGYFNFTSATVT
YLAQEDGPVVIGFTSAPGQGGILAQREFDRRFSPHFLDWAAFGVMTLPSIGVPLLLWYSS
KRKYDTPKTKKN
Download sequence
Identical sequences W5P574
ENSOARP00000005577

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]