SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000005677 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000005677
Domain Number 1 Region: 6-258
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 4.22e-95
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.000000412
Further Details:      
 
Domain Number 2 Region: 259-458
Classification Level Classification E-value
Superfamily Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) 1.16e-62
Family Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) 0.0000153
Further Details:      
 
Domain Number 3 Region: 597-760
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 8.89e-40
Family AlaX-like 0.04
Further Details:      
 
Domain Number 4 Region: 515-593
Classification Level Classification E-value
Superfamily Translation proteins 4.44e-16
Family AlaX-M N-terminal domain-like 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000005677   Gene: ENSOARG00000005286   Transcript: ENSOART00000005765
Sequence length 968
Comment pep:known_by_projection chromosome:Oar_v3.1:14:1177773:1196812:1 gene:ENSOARG00000005286 transcript:ENSOART00000005765 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSTLTAGEIRQRFIDFFKRNEHTYVHSSATIPLDDPTLLFANAGMNQFKPIFLNTIDPS
HPMAKLSRAANTQKCIRAGGKHNDLDDVGKDVYHHTFFEMLGSWSFGDYFKELACKMALE
LLTQEFGIPVERLYVTYFGGDEAAGLEPDLECKQIWQNLGLDDSRILPGSMKDNFWEMGD
TGPCGPCSEIHYDRVGGRDAAHLVNQDDPNVLEIWNLVFIQYNRETDGILKPLPKKSIDT
GMGLERLVSVLQNKMSNYDTDLFVPYFEAIQKGTGARPYTGKVGAEDADGIDMAYRVLAD
HARTITVALSDGGRPDNTGRGYVLRRILRRAVRYSHEKLNASRGFFATLVDVVVQSLGDA
FPELKKDPDMVKDIINEEEVQFLKTLSRGRRILDRKIQSLGDSKTIPGDTAWLLYDTYGF
PVDLTALIAEEKGLVVDMDGFDEERKLAQLKSQGKGAGGEDLIMLDIYAIEELREKGLEA
TDDSPKYSYHSDSNGTYVFESAVATVMALRRDKMFVEEVSTGQECGVVLDKTCFYAEQGG
QIYDEGYLVKVDDSSEDKTEFTVKNTQVRGGYVLHIGTLYGSLKVGDQVRLFIDEPRRRP
VMSNHTATHILNFALRSVLGEADQRGSLVAPDRLRFDFTAKGAMSTQQIKRAEEIANEMI
EAAKPVYTEDCSLAAAKAIQGLRAVFDETYPDPVRVVSIGVPVSELLDDPSGPAGSLTSV
EFCGGTHLQNSSHAGVFVIVSEEAIAKGIRRIVAVTGAEAQKALRKAESLKKSLSVMEAK
VKAQTAPNKDVQREIADLGEALATAIIPQWQKDEFRENLKSLKKVMDDLDRASKADVQKR
VLEKTKQLIDSSPNQPLVILEVESGASAKALNEALKLFKMHSPQTSAMLFTVDNEAGRIT
CLCQVPQNAANRGLKASEWVQQVSGLMDGKGGGKDVSAQATGKNVGCLQEALQLATSFAQ
LRLGDVKN
Download sequence
Identical sequences W5P5H4
XP_004014952.1.66739 ENSOARP00000005677

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]