SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000005723 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000005723
Domain Number 1 Region: 563-669
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.22e-19
Family Spermadhesin, CUB domain 0.0026
Further Details:      
 
Domain Number 2 Region: 675-739
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000032
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 3 Region: 734-796
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000153
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 4 Region: 345-410
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000403
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 5 Region: 801-861
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000117
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 6 Region: 228-346
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000000314
Family Spermadhesin, CUB domain 0.0093
Further Details:      
 
Domain Number 7 Region: 401-498
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000000327
Family Spermadhesin, CUB domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000005723   Gene: ENSOARG00000005328   Transcript: ENSOART00000005811
Sequence length 959
Comment pep:known_by_projection chromosome:Oar_v3.1:11:19945436:19970947:-1 gene:ENSOARG00000005328 transcript:ENSOART00000005811 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VKRKMGLPLPGLAFVTISGLSLEAPTEREGQAPGLEETDGELTAAPTPEQPAPGVHFVTT
APTLKLLNHHPLLEEFLQEGLEKGELRPDPPTASPLPRLANQDSRPVFTSPSPVMAAAPT
QPQSREGPWSLESEPPALRITAALPPGPSMAVPTPGPGERPNTTPPSGAWTPTPEGPGDI
GRPWAPGVMSQTTGLGMEGTVTTSTASGDDEETTTTSTIITTTVTTVQPPGPCSWNFSGP
EGSLDSPPASNSPPDVGLDCFYYISVYPGYGVEIKVQNISLREGETVTVEGLGGPDPLPL
ANQSFLLRGQVIRSPTHQAALRFQSLPPPAGPGTFHFHYQAYLLSCHFPQRPAYGAVTVT
SLHPGGSARFHCATGYQLKGARLLTCLNATQPFWDSQEPVCIAACGGVIRNATTGRIVSP
GEGQRLHLHFEKVSLAEDDDRLIIRNGDNVEAPPVYDSYEVEYLPIEGLLSSGRHFFVEL
STDSSGVAAGMALRYEAFQQGHCYEPFVKYGTRRRWGVPAVGRHSCGQEAAPGHGTGWGW
DGGWNAEGMRFPCLPAVCSGETTDSAGVVLSPNWPEPYGRGQDCIWGVHVEEDKRIMLDV
RVLRIGTGDVLTFYDGDDLTARVLGQYSGPRGHFKLFTSMADVTIQFQSDPGASVLGYQQ
GFVIHFFEVPRNDTCPELPEIPNGWKSPSQPELVHGTVVTYQCYPGYQVVGSSVLMCQWD
LTWSEDLPSCQRVTSCRDPGDVEHSRRLISSPKFPVGATVQYICDQGFVLTGSALLTCHD
RQASSPKWSDRAPKCLLEQLKPCHGLSAPENGARSPEKQLHPAGATVHFSCAPGYVLKGQ
ASIKCVPGHPSHWSDPPPICRAASLDGFYSGRSLDVAKVPAASSTLDAAHLAAAIFLPLV
AMALLVGGVYLYFCRLQGNSPLQLPRTRPRPYDRITVESAFDNPTYETGSLSFAGDERI
Download sequence
Identical sequences W5P5M0
ENSOARP00000005723

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]