SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000005906 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000005906
Domain Number 1 Region: 39-81
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.000000144
Family Somatomedin B domain 0.0051
Further Details:      
 
Domain Number 2 Region: 79-126
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000222
Family TSP-1 type 1 repeat 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000005906   Gene: ENSOARG00000005503   Transcript: ENSOART00000005996
Sequence length 269
Comment pep:known_by_projection chromosome:Oar_v3.1:9:49262472:49292863:-1 gene:ENSOARG00000005503 transcript:ENSOART00000005996 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SRTFWLTFSGLGRLWRGTGCPGKMAGCADAGRCGPGRAPACFASGWRQDRVYGTCFCDQA
CRVTGDCCFDYARACPARPCIVGEWSPWSGCAGQCRPMARVRRRAVQQEPQNGGEPCPAL
EERAGCLEYATPQGQDCGHAFVPAFITTSAFNKERTRQAASPHWTRNTEDAGYCMEFKTE
SLTHHCAMENRPLTRWMQYLREGYTVCVDCQPPAMNSVSLRCSGDGLDSDGNQTLHWQAI
GNPRCQGTWKKVRRVEQCSCPAVHSFIFI
Download sequence
Identical sequences W5P652
ENSOARP00000005906

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]